Lineage for d1y7ea1 (1y7e A:101-233)
- Root: SCOP 1.71
Class b: All beta proteins [48724] (149 folds) 
Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (3 superfamilies)
barrel, closed; n=6, S=8; greek-key
Superfamily b.49.3: Aminopeptidase/glucanase lid domain [101821] (1 family) 
Family b.49.3.1: Aminopeptidase/glucanase lid domain [101822] (4 proteins) 
Protein Probable aminopeptidase ApeA [117241] (1 species) Species Borrelia burgdorferi [TaxId:139] [117242] (1 PDB entry) 
Domain d1y7ea1: 1y7e A:101-233 [116532]
Other proteins in same PDB: d1y7ea2
Structural genomics target
Details for d1y7ea1
PDB Entry: 1y7e (more details), 3.2 Å
PDB Description: the crystal structure of aminopeptidase i from borrelia burgdorferi b31
SCOP Domain Sequences for d1y7ea1:
Sequence, based on SEQRES records: (download)
>d1y7ea1 b.49.3.1 (A:101-233) Probable aminopeptidase ApeA {Borrelia burgdorferi}
ldakpspiseeneltfiktnyyggikkyqwlstplsirgvvflkngekveinigdnendp
vfvipdilphldrkiqrnkksdeivegenlkiligslpietkeknkvklatlqlikekyk
ieeedfvsseiei
Sequence, based on observed residues (ATOM records): (download)
>d1y7ea1 b.49.3.1 (A:101-233) Probable aminopeptidase ApeA {Borrelia burgdorferi}
ldakpspiseeneltfiktnyyggikkyqwlstplsirgvvflkngekveinigdnendp
vfvipdilnlkiligslpietkeknkvklatlqlikekykieeedfvsseiei
SCOP Domain Coordinates for d1y7ea1:
Click to download the PDB-style file with coordinates for d1y7ea1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1y7ea1:
- d1y7ea1 is new in SCOP 1.71
- d1y7ea1 appears in SCOP 1.73
- d1y7ea1 appears in the current release, SCOPe 2.08
View in 3D
