Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.52: Restriction endonuclease-like [52979] (4 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest |
Superfamily c.52.1: Restriction endonuclease-like [52980] (37 families) |
Family c.52.1.28: RecU-like [117631] (2 proteins) Pfam PF03838 |
Protein Recombination protein U (RecU)/PBP related factor A (PrfA) [117632] (2 species) |
Species Bacillus stearothermophilus [TaxId:1422] [117634] (1 PDB entry) Uniprot Q5KXY4 31-198 # 99% sequence identity; Geobacillus kaustophilus TaxID: 1462 |
Domain d1y1od_: 1y1o D: [116348] Structural genomics target complexed with ni, so4 |
PDB Entry: 1y1o (more details), 2.2 Å
SCOPe Domain Sequences for d1y1od_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1y1od_ c.52.1.28 (D:) Recombination protein U (RecU)/PBP related factor A (PrfA) {Bacillus stearothermophilus [TaxId: 1422]} mtleddlnatneyyrergiavihkkptpvqivrvdypkrsaaviteayfrqasttdyngv yrgkyidfeaketknktafplknfhahqirhmeqvvahggicfailrfsllnetylldas hliawwnkqeaggrksipkqeierhghsiplgyqprldyisvvdnvyf
Timeline for d1y1od_: