Lineage for d1y1ob_ (1y1o B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2882263Fold c.52: Restriction endonuclease-like [52979] (4 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest
  4. 2882264Superfamily c.52.1: Restriction endonuclease-like [52980] (37 families) (S)
  5. 2882656Family c.52.1.28: RecU-like [117631] (2 proteins)
    Pfam PF03838
  6. 2882657Protein Recombination protein U (RecU)/PBP related factor A (PrfA) [117632] (2 species)
  7. 2882658Species Bacillus stearothermophilus [TaxId:1422] [117634] (1 PDB entry)
    Uniprot Q5KXY4 31-198 # 99% sequence identity; Geobacillus kaustophilus TaxID: 1462
  8. 2882660Domain d1y1ob_: 1y1o B: [116346]
    Structural genomics target
    complexed with ni, so4

Details for d1y1ob_

PDB Entry: 1y1o (more details), 2.2 Å

PDB Description: X-ray crystal Structure of Penicillin-binding protein-related factor A from Bacillus stearothermophilus
PDB Compounds: (B:) Penicillin-binding protein-related factor A

SCOPe Domain Sequences for d1y1ob_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1y1ob_ c.52.1.28 (B:) Recombination protein U (RecU)/PBP related factor A (PrfA) {Bacillus stearothermophilus [TaxId: 1422]}
mtleddlnatneyyrergiavihkkptpvqivrvdypkrsaaviteayfrqasttdyngv
yrgkyidfeaketknktafplknfhahqirhmeqvvahggicfailrfsllnetylldas
hliawwnkqeaggrksipkqeierhghsiplgyqprldyisvvdnvyf

SCOPe Domain Coordinates for d1y1ob_:

Click to download the PDB-style file with coordinates for d1y1ob_.
(The format of our PDB-style files is described here.)

Timeline for d1y1ob_: