PDB entry 1y1o

View 1y1o on RCSB PDB site
Description: X-ray crystal Structure of Penicillin-binding protein-related factor A from Bacillus stearothermophilus
Class: recombination
Keywords: structural genomics, Protein Structure Initiative, PSI, Midwest Center for Structural Genomics, MCSG, Penicillin-binding protein, RECOMBINATION
Deposited on 2004-11-19, released 2004-12-07
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.199
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Penicillin-binding protein-related factor A
    Species: Geobacillus stearothermophilus [TaxId:1422]
    Gene: RBSTP1992
    Database cross-references and differences (RAF-indexed):
    • PDB 1Y1O
    Domains in SCOPe 2.08: d1y1oa_
  • Chain 'B':
    Compound: Penicillin-binding protein-related factor A
    Species: Geobacillus stearothermophilus [TaxId:1422]
    Gene: RBSTP1992
    Database cross-references and differences (RAF-indexed):
    • PDB 1Y1O
    Domains in SCOPe 2.08: d1y1ob_
  • Chain 'C':
    Compound: Penicillin-binding protein-related factor A
    Species: Geobacillus stearothermophilus [TaxId:1422]
    Gene: RBSTP1992
    Database cross-references and differences (RAF-indexed):
    • PDB 1Y1O
    Domains in SCOPe 2.08: d1y1oc_
  • Chain 'D':
    Compound: Penicillin-binding protein-related factor A
    Species: Geobacillus stearothermophilus [TaxId:1422]
    Gene: RBSTP1992
    Database cross-references and differences (RAF-indexed):
    • PDB 1Y1O
    Domains in SCOPe 2.08: d1y1od_
  • Heterogens: SO4, NI, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1y1oA (A:)
    snamalkypsgkeyrgnkpnaarrpaadyanrgmtleddlnatneyyrergiavihkkpt
    pvqivrvdypkrsaaviteayfrqasttdyngvyrgkyidfeaketknktafplknfhah
    qirhmeqvvahggicfailrfsllnetylldashliawwnkqeaggrksipkqeierhgh
    siplgyqprldyisvvdnvyftr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1y1oA (A:)
    mtleddlnatneyyrergiavihkkptpvqivrvdypkrsaaviteayfrqasttdyngv
    yrgkyidfeaketknktafplknfhahqirhmeqvvahggicfailrfsllnetylldas
    hliawwnkqeaggrksipkqeierhghsiplgyqprldyisvvdnvyf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1y1oB (B:)
    snamalkypsgkeyrgnkpnaarrpaadyanrgmtleddlnatneyyrergiavihkkpt
    pvqivrvdypkrsaaviteayfrqasttdyngvyrgkyidfeaketknktafplknfhah
    qirhmeqvvahggicfailrfsllnetylldashliawwnkqeaggrksipkqeierhgh
    siplgyqprldyisvvdnvyftr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1y1oB (B:)
    mtleddlnatneyyrergiavihkkptpvqivrvdypkrsaaviteayfrqasttdyngv
    yrgkyidfeaketknktafplknfhahqirhmeqvvahggicfailrfsllnetylldas
    hliawwnkqeaggrksipkqeierhghsiplgyqprldyisvvdnvyf
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1y1oC (C:)
    snamalkypsgkeyrgnkpnaarrpaadyanrgmtleddlnatneyyrergiavihkkpt
    pvqivrvdypkrsaaviteayfrqasttdyngvyrgkyidfeaketknktafplknfhah
    qirhmeqvvahggicfailrfsllnetylldashliawwnkqeaggrksipkqeierhgh
    siplgyqprldyisvvdnvyftr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1y1oC (C:)
    mtleddlnatneyyrergiavihkkptpvqivrvdypkrsaaviteayfrqasttdyngv
    yrgkyidfeaketknktafplknfhahqirhmeqvvahggicfailrfsllnetylldas
    hliawwnkqeaggrksipkqeierhghsiplgyqprldyisvvdnvyf
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1y1oD (D:)
    snamalkypsgkeyrgnkpnaarrpaadyanrgmtleddlnatneyyrergiavihkkpt
    pvqivrvdypkrsaaviteayfrqasttdyngvyrgkyidfeaketknktafplknfhah
    qirhmeqvvahggicfailrfsllnetylldashliawwnkqeaggrksipkqeierhgh
    siplgyqprldyisvvdnvyftr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1y1oD (D:)
    mtleddlnatneyyrergiavihkkptpvqivrvdypkrsaaviteayfrqasttdyngv
    yrgkyidfeaketknktafplknfhahqirhmeqvvahggicfailrfsllnetylldas
    hliawwnkqeaggrksipkqeierhghsiplgyqprldyisvvdnvyf