Lineage for d1xxih2 (1xxi H:5-242)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1593542Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 1593543Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 1597497Family c.37.1.20: Extended AAA-ATPase domain [81269] (29 proteins)
    fold is similar to that of RecA, but lacks the last two strands, followed by a family-specific Arg-finger domain
  6. 1597600Protein gamma subunit of DNA polymerase III, N-domain [64031] (2 species)
  7. 1597601Species Escherichia coli [TaxId:562] [64032] (3 PDB entries)
    Uniprot P06710 5-368
  8. 1597615Domain d1xxih2: 1xxi H:5-242 [116198]
    Other proteins in same PDB: d1xxia1, d1xxia2, d1xxib1, d1xxic1, d1xxid1, d1xxie1, d1xxie2, d1xxif1, d1xxif2, d1xxig1, d1xxih1, d1xxii1, d1xxij1, d1xxij2
    protein/DNA complex; complexed with adp, po4, zn

Details for d1xxih2

PDB Entry: 1xxi (more details), 4.1 Å

PDB Description: ADP Bound E. coli Clamp Loader Complex
PDB Compounds: (H:) DNA polymerase III subunit gamma

SCOPe Domain Sequences for d1xxih2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xxih2 c.37.1.20 (H:5-242) gamma subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]}
vlarkwrpqtfadvvgqehvltalanglslgrihhaylfsgtrgvgktsiarllakglnc
etgitatpcgvcdncreieqgrfvdlieidaasrtkvedtrdlldnvqyapargrfkvyl
idevhmlsrhsfnallktleeppehvkfllattdpqklpvtilsrclqfhlkaldveqir
hqlehilneehiahepralqllaraaegslrdalsltdqaiasgdgqvstqavsamlg

SCOPe Domain Coordinates for d1xxih2:

Click to download the PDB-style file with coordinates for d1xxih2.
(The format of our PDB-style files is described here.)

Timeline for d1xxih2: