| Class a: All alpha proteins [46456] (285 folds) |
| Fold a.80: post-AAA+ oligomerization domain-like [48018] (1 superfamily) core: 5 helices: bundle |
Superfamily a.80.1: post-AAA+ oligomerization domain-like [48019] (2 families) ![]() associated with N-terminal domain from the AAA+ family of P-loop hydrolases |
| Family a.80.1.1: DNA polymerase III clamp loader subunits, C-terminal domain [48020] (9 proteins) contains an extra helix |
| Protein delta subunit [63580] (1 species) |
| Species Escherichia coli [TaxId:562] [63581] (4 PDB entries) Uniprot P28630 |
| Domain d1xxif1: 1xxi F:212-338 [116193] Other proteins in same PDB: d1xxia2, d1xxib1, d1xxib2, d1xxic1, d1xxic2, d1xxid1, d1xxid2, d1xxie1, d1xxie2, d1xxif2, d1xxig1, d1xxig2, d1xxih1, d1xxih2, d1xxii1, d1xxii2, d1xxij1, d1xxij2 protein/DNA complex; complexed with adp, po4, zn |
PDB Entry: 1xxi (more details), 4.1 Å
SCOPe Domain Sequences for d1xxif1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xxif1 a.80.1.1 (F:212-338) delta subunit {Escherichia coli [TaxId: 562]}
ftpfhwvdallmgkskralhilqqlrlegsepvillrtlqrellllvnlkrqsahtplra
lfdkhrvwqnrrgmmgealnrlsqtqlrqavqlltrteltlkqdygqsvwaeleglslll
chkplad
Timeline for d1xxif1: