SCOPe 2.08: Domain d1xxie1: 1xxi E:208-334

Lineage for d1xxie1 (1xxi E:208-334)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.80: post-AAA+ oligomerization domain-like [48018] (1 superfamily)
   core: 5 helices: bundle

4. Superfamily a.80.1: post-AAA+ oligomerization domain-like [48019] (2 families)
   associated with N-terminal domain from the AAA+ family of P-loop hydrolases

5. Family a.80.1.1: DNA polymerase III clamp loader subunits, C-terminal domain [48020] (9 proteins)
   contains an extra helix

6. Protein delta prime subunit [48021] (1 species)

7. Species Escherichia coli [TaxId:562] [48022] (4 PDB entries)
   Uniprot P28631

8. Domain d1xxie1: 1xxi E:208-334 [116191]
   Other proteins in same PDB: d1xxia1, d1xxia2, d1xxib1, d1xxib2, d1xxic1, d1xxic2, d1xxid1, d1xxid2, d1xxie2, d1xxif1, d1xxif2, d1xxig1, d1xxig2, d1xxih1, d1xxih2, d1xxii1, d1xxii2, d1xxij2
   protein/DNA complex; complexed with adp, po4, zn

Details for d1xxie1

PDB Entry: 1xxi, 4.1 Å

PDB Description: ADP Bound E. coli Clamp Loader Complex

PDB Compounds: (E:) DNA polymerase III, delta prime subunit

SCOPe Domain Sequences for d1xxie1:

Sequence; same for both SEQRES and ATOM records:

>d1xxie1 a.80.1.1 (E:208-334) delta prime subunit {Escherichia coli [TaxId: 562]}
dnwqaretlcqalaysvpsgdwysllaalnheqaparlhwlatllmdalkrhhgaaqvtn
vdvpglvaelanhlspsrlqailgdvchireqlmsvtginrellitdlllriehylqpgv
vlpvphl

Timeline for d1xxie1:

• d1xxie1 first appeared in SCOP 1.71
  
• d1xxie1 appears in SCOPe 2.07