| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) ![]() division into families based on beta-sheet topologies |
| Family c.37.1.20: Extended AAA-ATPase domain [81269] (43 proteins) fold is similar to that of RecA, but lacks the last two strands, followed by a family-specific Arg-finger domain |
| Protein gamma subunit of DNA polymerase III, N-domain [64031] (2 species) |
| Species Escherichia coli [TaxId:562] [64032] (3 PDB entries) Uniprot P06710 5-368 |
| Domain d1xxib2: 1xxi B:5-242 [116186] Other proteins in same PDB: d1xxia1, d1xxia2, d1xxib1, d1xxic1, d1xxid1, d1xxie1, d1xxie2, d1xxif1, d1xxif2, d1xxig1, d1xxih1, d1xxii1, d1xxij1, d1xxij2 protein/DNA complex; complexed with adp, po4, zn |
PDB Entry: 1xxi (more details), 4.1 Å
SCOPe Domain Sequences for d1xxib2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xxib2 c.37.1.20 (B:5-242) gamma subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]}
vlarkwrpqtfadvvgqehvltalanglslgrihhaylfsgtrgvgktsiarllakglnc
etgitatpcgvcdncreieqgrfvdlieidaasrtkvedtrdlldnvqyapargrfkvyl
idevhmlsrhsfnallktleeppehvkfllattdpqklpvtilsrclqfhlkaldveqir
hqlehilneehiahepralqllaraaegslrdalsltdqaiasgdgqvstqavsamlg
Timeline for d1xxib2: