Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) division into families based on beta-sheet topologies |
Family c.37.1.20: Extended AAA-ATPase domain [81269] (43 proteins) fold is similar to that of RecA, but lacks the last two strands, followed by a family-specific Arg-finger domain |
Protein delta subunit of DNA polymerase III, N-domain [64033] (1 species) |
Species Escherichia coli [TaxId:562] [64034] (5 PDB entries) Uniprot P28630 |
Domain d1xxia2: 1xxi A:1-211 [116184] Other proteins in same PDB: d1xxia1, d1xxib1, d1xxib2, d1xxic1, d1xxic2, d1xxid1, d1xxid2, d1xxie1, d1xxie2, d1xxif1, d1xxig1, d1xxig2, d1xxih1, d1xxih2, d1xxii1, d1xxii2, d1xxij1, d1xxij2 protein/DNA complex; complexed with adp, po4, zn |
PDB Entry: 1xxi (more details), 4.1 Å
SCOPe Domain Sequences for d1xxia2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xxia2 c.37.1.20 (A:1-211) delta subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} mirlypeqlraqlneglraaylllgndplllqesqdavrqvaaaqgfeehhtfsidpntd wnaifslcqamslfasrqtlllllpengpnaaineqlltltgllhddlllivrgnklska qenaawftalanrsvqvtcqtpeqaqlprwvaarakqlnlelddaanqvlcycyegnlla laqalerlsllwpdgkltlprveqavndaah
Timeline for d1xxia2: