Lineage for d1xxia2 (1xxi A:1-211)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. Family c.37.1.20: Extended AAA-ATPase domain [81269] (43 proteins)
    fold is similar to that of RecA, but lacks the last two strands, followed by a family-specific Arg-finger domain
  6. Protein delta subunit of DNA polymerase III, N-domain [64033] (1 species)
  7. Species Escherichia coli [TaxId:562] [64034] (5 PDB entries)
    Uniprot P28630
  8. Domain d1xxia2: 1xxi A:1-211 [116184]
    Other proteins in same PDB: d1xxia1, d1xxib1, d1xxib2, d1xxic1, d1xxic2, d1xxid1, d1xxid2, d1xxie1, d1xxie2, d1xxif1, d1xxig1, d1xxig2, d1xxih1, d1xxih2, d1xxii1, d1xxii2, d1xxij1, d1xxij2
    protein/DNA complex; complexed with adp, po4, zn

Details for d1xxia2

PDB Entry: 1xxi (more details), 4.1 Å

PDB Description: ADP Bound E. coli Clamp Loader Complex
PDB Compounds: (A:) DNA Polymerase III, DELTA SUBUNIT

SCOPe Domain Sequences for d1xxia2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xxia2 c.37.1.20 (A:1-211) delta subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]}
mirlypeqlraqlneglraaylllgndplllqesqdavrqvaaaqgfeehhtfsidpntd
wnaifslcqamslfasrqtlllllpengpnaaineqlltltgllhddlllivrgnklska
qenaawftalanrsvqvtcqtpeqaqlprwvaarakqlnlelddaanqvlcycyegnlla
laqalerlsllwpdgkltlprveqavndaah

SCOPe Domain Coordinates for d1xxia2 are not available.

Timeline for d1xxia2:

Domains from same chain:
(mouse over for more information)
d1xxia1
Domains from other chains:
(mouse over for more information)
d1xxib1, d1xxib2, d1xxic1, d1xxic2, d1xxid1, d1xxid2, d1xxie1, d1xxie2, d1xxif1, d1xxif2, d1xxig1, d1xxig2, d1xxih1, d1xxih2, d1xxii1, d1xxii2, d1xxij1, d1xxij2