![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.23: ApaG-like [110069] (2 families) ![]() |
![]() | Family b.1.23.1: ApaG-like [110070] (1 protein) Pfam PF04379; dimeric in crystals; this dimer is a probable biological unit |
![]() | Protein ApaG [110071] (4 species) |
![]() | Species Vibrio cholerae [TaxId:666] [117065] (1 PDB entry) Uniprot Q9KUS3 |
![]() | Domain d1xvsa_: 1xvs A: [116095] Structural genomics target complexed with gol |
PDB Entry: 1xvs (more details), 2.01 Å
SCOPe Domain Sequences for d1xvsa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xvsa_ b.1.23.1 (A:) ApaG {Vibrio cholerae [TaxId: 666]} mdvslpcikiqvqtryieeqsnpeyqrfvfaylitiknlssqtvqlmsrrwlitdadgkq tvvegdgvvgeqprikandeytyssgtaldtpvgvmqgqylmideqgesftveiepfrla vphv
Timeline for d1xvsa_: