PDB entry 1xvs

View 1xvs on RCSB PDB site
Description: Crystal structure of apaG Protein from Vibrio cholerae
Class: structural genomics, unknown function
Keywords: apaG, MCSG APC26324, Midwest Center for Structural Genomics, protein structure initiative, PSI, STRUCTURAL GENOMICS, UNKNOWN FUNCTION
Deposited on 2004-10-28, released 2004-12-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.01 Å
R-factor: 0.184
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein apaG
    Species: Vibrio cholerae [TaxId:666]
    Gene: apaG
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9KUS3 (0-End)
      • modified residue (0)
      • modified residue (46)
      • modified residue (95)
      • modified residue (101)
    Domains in SCOPe 2.07: d1xvsa_
  • Chain 'B':
    Compound: Protein apaG
    Species: Vibrio cholerae [TaxId:666]
    Gene: apaG
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9KUS3 (0-End)
      • modified residue (0)
      • modified residue (46)
      • modified residue (95)
      • modified residue (101)
    Domains in SCOPe 2.07: d1xvsb_
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xvsA (A:)
    mdvslpcikiqvqtryieeqsnpeyqrfvfaylitiknlssqtvqlmsrrwlitdadgkq
    tvvegdgvvgeqprikandeytyssgtaldtpvgvmqgqylmideqgesftveiepfrla
    vphvln
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xvsA (A:)
    mdvslpcikiqvqtryieeqsnpeyqrfvfaylitiknlssqtvqlmsrrwlitdadgkq
    tvvegdgvvgeqprikandeytyssgtaldtpvgvmqgqylmideqgesftveiepfrla
    vphv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1xvsB (B:)
    mdvslpcikiqvqtryieeqsnpeyqrfvfaylitiknlssqtvqlmsrrwlitdadgkq
    tvvegdgvvgeqprikandeytyssgtaldtpvgvmqgqylmideqgesftveiepfrla
    vphvln
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xvsB (B:)
    mdvslpcikiqvqtryieeqsnpeyqrfvfaylitiknlssqtvqlmsrrwlitdadgkq
    tvvegdgvvgeqprikandeytyssgtaldtpvgvmqgqylmideqgesftveiepfrla
    vphv