SCOPe 2.08: Domain d1xvsb_: 1xvs B:

Lineage for d1xvsb_ (1xvs B:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.23: ApaG-like [110069] (2 families)

5. Family b.1.23.1: ApaG-like [110070] (1 protein)
   Pfam PF04379; dimeric in crystals; this dimer is a probable biological unit

6. Protein ApaG [110071] (4 species)

7. Species Vibrio cholerae [TaxId:666] [117065] (1 PDB entry)
   Uniprot Q9KUS3

8. Domain d1xvsb_: 1xvs B: [116096]
   Structural genomics target
   complexed with gol

Details for d1xvsb_

PDB Entry: 1xvs, 2.01 Å

PDB Description: Crystal structure of apaG Protein from Vibrio cholerae

PDB Compounds: (B:) Protein apaG

SCOPe Domain Sequences for d1xvsb_:

Sequence; same for both SEQRES and ATOM records:

>d1xvsb_ b.1.23.1 (B:) ApaG {Vibrio cholerae [TaxId: 666]}
mdvslpcikiqvqtryieeqsnpeyqrfvfaylitiknlssqtvqlmsrrwlitdadgkq
tvvegdgvvgeqprikandeytyssgtaldtpvgvmqgqylmideqgesftveiepfrla
vphv

Timeline for d1xvsb_:

• d1xvsb_ first appeared in SCOP 1.71
  
• d1xvsb_ appears in SCOPe 2.07