Class b: All beta proteins [48724] (149 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.23: ApaG-like [110069] (1 family) |
Family b.1.23.1: ApaG-like [110070] (1 protein) Pfam 04379; dimeric in crystals; this dimer is a probable biological unit |
Protein ApaG [110071] (3 species) |
Species Vibrio cholerae [TaxId:666] [117065] (1 PDB entry) |
Domain d1xvsa_: 1xvs A: [116095] |
PDB Entry: 1xvs (more details), 2.01 Å
SCOP Domain Sequences for d1xvsa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xvsa_ b.1.23.1 (A:) ApaG {Vibrio cholerae} mdvslpcikiqvqtryieeqsnpeyqrfvfaylitiknlssqtvqlmsrrwlitdadgkq tvvegdgvvgeqprikandeytyssgtaldtpvgvmqgqylmideqgesftveiepfrla vphv
Timeline for d1xvsa_: