Lineage for d1xvsa_ (1xvs A:)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 546418Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 552548Superfamily b.1.23: ApaG-like [110069] (1 family) (S)
  5. 552549Family b.1.23.1: ApaG-like [110070] (1 protein)
    Pfam 04379; dimeric in crystals; this dimer is a probable biological unit
  6. 552550Protein ApaG [110071] (3 species)
  7. 552559Species Vibrio cholerae [TaxId:666] [117065] (1 PDB entry)
  8. 552560Domain d1xvsa_: 1xvs A: [116095]

Details for d1xvsa_

PDB Entry: 1xvs (more details), 2.01 Å

PDB Description: Crystal structure of apaG Protein from Vibrio cholerae

SCOP Domain Sequences for d1xvsa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xvsa_ b.1.23.1 (A:) ApaG {Vibrio cholerae}
mdvslpcikiqvqtryieeqsnpeyqrfvfaylitiknlssqtvqlmsrrwlitdadgkq
tvvegdgvvgeqprikandeytyssgtaldtpvgvmqgqylmideqgesftveiepfrla
vphv

SCOP Domain Coordinates for d1xvsa_:

Click to download the PDB-style file with coordinates for d1xvsa_.
(The format of our PDB-style files is described here.)

Timeline for d1xvsa_: