SCOPe 2.08: Domain d1xu9a1: 1xu9 A:24-289

Lineage for d1xu9a1 (1xu9 A:24-289)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (73 proteins)
   also known as short-chain dehydrogenases and SDR family
   parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7
   has additional subdomain(s) that are not in the common domain
   

6. Protein 11-beta-hydroxysteroid dehydrogenase 1 [117423] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [117424] (29 PDB entries)
   Uniprot P28845

8. Domain d1xu9a1: 1xu9 A:24-289 [116052]
   Other proteins in same PDB: d1xu9a2, d1xu9b2, d1xu9c2, d1xu9d2
   complexed with cps, mes, ndp

Details for d1xu9a1

PDB Entry: 1xu9, 1.55 Å

PDB Description: crystal structure of the interface closed conformation of 11b- hydroxysteroid dehydrogenase isozyme 1

PDB Compounds: (A:) Corticosteroid 11-beta-dehydrogenase, isozyme 1

SCOPe Domain Sequences for d1xu9a1:

Sequence; same for both SEQRES and ATOM records:

>d1xu9a1 c.2.1.2 (A:24-289) 11-beta-hydroxysteroid dehydrogenase 1 {Human (Homo sapiens) [TaxId: 9606]}
neefrpemlqgkkvivtgaskgigremayhlakmgahvvvtarsketlqkvvshclelga
asahyiagtmedmtfaeqfvaqagklmggldmlilnhitntslnlfhddihhvrksmevn
flsyvvltvaalpmlkqsngsivvvsslagkvaypmvaaysaskfaldgffssirkeysv
srvnvsitlcvlglidtetamkavsgivhmqaapkeecaleiikggalrqeevyydsslw
ttllirnpsrkileflystsynmdrf

Timeline for d1xu9a1:

• d1xu9a1 first appeared in SCOP 1.71, called d1xu9a_
  
• d1xu9a1 appears in SCOPe 2.07