SCOPe 2.08: Domain d1xtoa1: 1xto A:1-303

Lineage for d1xtoa1 (1xto A:1-303)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
   duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets

4. Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (16 families)

5. Family d.157.1.6: Coenzyme PQQ synthesis protein B, PqqB [118146] (2 proteins)

6. Protein Coenzyme PQQ synthesis protein B, PqqB [118147] (1 species)

7. Species Pseudomonas putida [TaxId:303] [118148] (1 PDB entry)
   Uniprot Q88QV5

8. Domain d1xtoa1: 1xto A:1-303 [116030]
   Other proteins in same PDB: d1xtoa2
   Structural genomics target
   complexed with zn

Details for d1xtoa1

PDB Entry: 1xto, 2.8 Å

PDB Description: crystal structure of the coenzyme pqq synthesis protein (pqqb) from pseudomonas putida, northeast structural genomics target ppr6

PDB Compounds: (A:) Coenzyme PQQ synthesis protein B

SCOPe Domain Sequences for d1xtoa1:

Sequence; same for both SEQRES and ATOM records:

>d1xtoa1 d.157.1.6 (A:1-303) Coenzyme PQQ synthesis protein B, PqqB {Pseudomonas putida [TaxId: 303]}
myiqvlgsaagggfpqwncncvnckgyrdgtlkatartqssialsddgvhwilcnaspdi
raqlqafapmqparalrdtginaivlldsqidhttgllslregcphqvwctdmvhqdltt
gfplfnmlshwngglqwnrielegsfvidacpnlkftpfplrsaappysphrfdphpgdn
lglmvedtrtggklfyapglgqvdekllammhgadcllvdgtlweddemqrrgvgtrtgr
emghlaqngpggmlevldgfprqrkvlihinntnpildensperaevlrrgvevafdgms
iel

Timeline for d1xtoa1:

• d1xtoa1 first appeared in SCOP 1.71, called d1xtoa_
  
• d1xtoa1 appears in SCOPe 2.07