Lineage for d1xtoa1 (1xto A:1-303)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2602905Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
    duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets
  4. 2602906Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (15 families) (S)
  5. 2603386Family d.157.1.6: Coenzyme PQQ synthesis protein B, PqqB [118146] (2 proteins)
  6. 2603387Protein Coenzyme PQQ synthesis protein B, PqqB [118147] (1 species)
  7. 2603388Species Pseudomonas putida [TaxId:303] [118148] (1 PDB entry)
    Uniprot Q88QV5
  8. 2603389Domain d1xtoa1: 1xto A:1-303 [116030]
    Other proteins in same PDB: d1xtoa2
    Structural genomics target
    complexed with zn

Details for d1xtoa1

PDB Entry: 1xto (more details), 2.8 Å

PDB Description: crystal structure of the coenzyme pqq synthesis protein (pqqb) from pseudomonas putida, northeast structural genomics target ppr6
PDB Compounds: (A:) Coenzyme PQQ synthesis protein B

SCOPe Domain Sequences for d1xtoa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xtoa1 d.157.1.6 (A:1-303) Coenzyme PQQ synthesis protein B, PqqB {Pseudomonas putida [TaxId: 303]}
myiqvlgsaagggfpqwncncvnckgyrdgtlkatartqssialsddgvhwilcnaspdi
raqlqafapmqparalrdtginaivlldsqidhttgllslregcphqvwctdmvhqdltt
gfplfnmlshwngglqwnrielegsfvidacpnlkftpfplrsaappysphrfdphpgdn
lglmvedtrtggklfyapglgqvdekllammhgadcllvdgtlweddemqrrgvgtrtgr
emghlaqngpggmlevldgfprqrkvlihinntnpildensperaevlrrgvevafdgms
iel

SCOPe Domain Coordinates for d1xtoa1:

Click to download the PDB-style file with coordinates for d1xtoa1.
(The format of our PDB-style files is described here.)

Timeline for d1xtoa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1xtoa2