PDB entry 1xto

View 1xto on RCSB PDB site
Description: Crystal Structure of the Coenzyme PQQ Synthesis Protein (PqqB) from Pseudomonas putida, Northeast Structural Genomics Target PpR6
Class: structural genomics, unknown function
Keywords: alpha-beta protein, Northeast Structural Genomics Consortium, NESG, Protein Structure Initiative, PSI, Structural Genomics, UNKNOWN FUNCTION
Deposited on 2004-10-22, released 2004-11-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: N/A
AEROSPACI score: 0.14 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Coenzyme PQQ synthesis protein B
    Species: Pseudomonas putida [TaxId:160488]
    Gene: pqqB
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q88QV5 (0-302)
      • modified residue (0)
      • modified residue (69)
      • modified residue (112)
      • modified residue (126)
      • modified residue (183)
      • modified residue (209-210)
      • modified residue (228)
      • modified residue (241)
      • modified residue (252)
      • modified residue (298)
      • cloning artifact (303)
    Domains in SCOPe 2.07: d1xtoa1, d1xtoa2
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xtoA (A:)
    myiqvlgsaagggfpqwncncvnckgyrdgtlkatartqssialsddgvhwilcnaspdi
    raqlqafapmqparalrdtginaivlldsqidhttgllslregcphqvwctdmvhqdltt
    gfplfnmlshwngglqwnrielegsfvidacpnlkftpfplrsaappysphrfdphpgdn
    lglmvedtrtggklfyapglgqvdekllammhgadcllvdgtlweddemqrrgvgtrtgr
    emghlaqngpggmlevldgfprqrkvlihinntnpildensperaevlrrgvevafdgms
    iellehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xtoA (A:)
    myiqvlgsaagggfpqwncncvnckgyrdgtlkatartqssialsddgvhwilcnaspdi
    raqlqafapmqparalrdtginaivlldsqidhttgllslregcphqvwctdmvhqdltt
    gfplfnmlshwngglqwnrielegsfvidacpnlkftpfplrsaappysphrfdphpgdn
    lglmvedtrtggklfyapglgqvdekllammhgadcllvdgtlweddemqrrgvgtrtgr
    emghlaqngpggmlevldgfprqrkvlihinntnpildensperaevlrrgvevafdgms
    iell