SCOPe 2.08: Domain d1xtka1: 1xtk A:46-254

Lineage for d1xtka1 (1xtk A:46-254)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.19: Tandem AAA-ATPase domain [81268] (41 proteins)
   duplication: tandem repeat of two RecA-like (AAA) domains

6. Protein Spliceosome RNA helicase BAT1 (UAP56) [110562] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [110563] (5 PDB entries)
   Uniprot Q13838 45-428

8. Domain d1xtka1: 1xtk A:46-254 [116026]
   complexed with bme; mutant

Details for d1xtka1

PDB Entry: 1xtk, 2.4 Å

PDB Description: structure of decd to dead mutation of human uap56

PDB Compounds: (A:) Probable ATP-dependent RNA helicase p47

SCOPe Domain Sequences for d1xtka1:

Sequence; same for both SEQRES and ATOM records:

>d1xtka1 c.37.1.19 (A:46-254) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]}
gfrdfllkpellraivdcgfehpsevqhecipqailgmdvlcqaksgmgktavfvlatlq
qlepvtgqvsvlvmchtrelafqiskeyerfskympnvkvavffgglsikkdeevlkknc
phivvgtpgrilalarnkslnlkhikhfildeadkmleqldmrrdvqeifrmtphekqvm
mfsatlskeirpvcrkfmqdpmeifvdde

Timeline for d1xtka1:

• d1xtka1 first appeared in SCOP 1.71
  
• d1xtka1 appears in SCOPe 2.07