PDB entry 1xtk

View 1xtk on RCSB PDB site
Description: structure of DECD to DEAD mutation of human UAP56
Class: gene regulation
Keywords: alpha-beta fold, GENE REGULATION
Deposited on 2004-10-22, released 2004-12-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.25
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Probable ATP-dependent RNA helicase p47
    Species: Homo sapiens [TaxId:9606]
    Gene: BAT1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q13838
      • engineered (159)
    Domains in SCOPe 2.07: d1xtka1, d1xtka2
  • Heterogens: BME, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xtkA (A:)
    gspghmsgfrdfllkpellraivdcgfehpsevqhecipqailgmdvlcqaksgmgktav
    fvlatlqqlepvtgqvsvlvmchtrelafqiskeyerfskympnvkvavffgglsikkde
    evlkkncphivvgtpgrilalarnkslnlkhikhfildeadkmleqldmrrdvqeifrmt
    phekqvmmfsatlskeirpvcrkfmqdpmeifvddetkltlhglqqyyvklkdneknrkl
    fdlldvlefnqvvifvksvqrcialaqllveqnfpaiaihrgmpqeerlsryqqfkdfqr
    rilvatnlfgrgmdiervniafnydmpedsdtylhrvaragrfgtkglaitfvsdendak
    ilndvqdrfevniselpdeidissyieqtr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xtkA (A:)
    gfrdfllkpellraivdcgfehpsevqhecipqailgmdvlcqaksgmgktavfvlatlq
    qlepvtgqvsvlvmchtrelafqiskeyerfskympnvkvavffgglsikkdeevlkknc
    phivvgtpgrilalarnkslnlkhikhfildeadkmleqldmrrdvqeifrmtphekqvm
    mfsatlskeirpvcrkfmqdpmeifvddetkltlhglqqyyvklkdneknrklfdlldvl
    efnqvvifvksvqrcialaqllveqnfpaiaihrgmpqeerlsryqqfkdfqrrilvatn
    lfgrgmdiervniafnydmpedsdtylhrvaragrfgtkglaitfvsdendakilndvqd
    rfevniselpdeidissyieqt