SCOP 1.71: Domain d1xr0b_: 1xr0 B:

Lineage for d1xr0b_ (1xr0 B:)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.55: PH domain-like [50728] (1 superfamily)
   barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix

4. Superfamily b.55.1: PH domain-like [50729] (9 families)

5. Family b.55.1.2: Phosphotyrosine-binding domain (PTB) [50755] (10 proteins)
   Pfam 00640

6. Protein FGFR substrate 2 (SNT-1) [117257] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [117258] (1 PDB entry)

8. Domain d1xr0b_: 1xr0 B: [115858]
   complexed with BFGFR-1 peptide (SQ Q04589 409-430), chain A

Details for d1xr0b_

PDB Entry: 1xr0

PDB Description: structural basis of snt ptb domain interactions with distinct neurotrophic receptors

SCOP Domain Sequences for d1xr0b_:

Sequence; same for both SEQRES and ATOM records:

>d1xr0b_ b.55.1.2 (B:) FGFR substrate 2 (SNT-1) {Human (Homo sapiens)}
mgsdtvpdnhrnkfkvinvdddgnelgsgimeltdtelilytrkrdsvkwhylclrrygy
dsnlfsfesgrrcqtgqgifafkcaraeelfnmlqeimqnnsinvveepvvernnhqtel
evprtprtp

Timeline for d1xr0b_:

• d1xr0b_ is new in SCOP 1.71
  
• d1xr0b_ appears in SCOP 1.73
  
• d1xr0b_ appears in the current release, SCOPe 2.08, called d1xr0b1