Lineage for d1xr0b1 (1xr0 B:11-136)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2803065Fold b.55: PH domain-like barrel [50728] (3 superfamilies)
    barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix
  4. 2803066Superfamily b.55.1: PH domain-like [50729] (14 families) (S)
  5. 2803365Family b.55.1.2: Phosphotyrosine-binding domain (PTB) [50755] (13 proteins)
    Pfam PF00640
  6. 2803397Protein FGFR substrate 2 (SNT-1) [117257] (1 species)
  7. 2803398Species Human (Homo sapiens) [TaxId:9606] [117258] (1 PDB entry)
    Uniprot Q7LDQ6 11-129
  8. 2803399Domain d1xr0b1: 1xr0 B:11-136 [115858]
    Other proteins in same PDB: d1xr0b2
    complexed with BFGFR-1 peptide (Uniprot Q04589 409-430), chain A

Details for d1xr0b1

PDB Entry: 1xr0 (more details)

PDB Description: structural basis of snt ptb domain interactions with distinct neurotrophic receptors
PDB Compounds: (B:) FGFR signalling adaptor SNT-1

SCOPe Domain Sequences for d1xr0b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xr0b1 b.55.1.2 (B:11-136) FGFR substrate 2 (SNT-1) {Human (Homo sapiens) [TaxId: 9606]}
dtvpdnhrnkfkvinvdddgnelgsgimeltdtelilytrkrdsvkwhylclrrygydsn
lfsfesgrrcqtgqgifafkcaraeelfnmlqeimqnnsinvveepvvernnhqtelevp
rtprtp

SCOPe Domain Coordinates for d1xr0b1:

Click to download the PDB-style file with coordinates for d1xr0b1.
(The format of our PDB-style files is described here.)

Timeline for d1xr0b1: