PDB entry 1xr0

View 1xr0 on RCSB PDB site
Description: structural basis of snt ptb domain interactions with distinct neurotrophic receptors
Deposited on 2004-10-13, released 2004-11-02
The last revision prior to the SCOP 1.71 freeze date was dated 2004-11-02, with a file datestamp of 2004-11-02.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'B':
    Domains in SCOP 1.71: d1xr0b_

PDB Chain Sequences:

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1xr0B (B:)
    mgsdtvpdnhrnkfkvinvdddgnelgsgimeltdtelilytrkrdsvkwhylclrrygy
    dsnlfsfesgrrcqtgqgifafkcaraeelfnmlqeimqnnsinvveepvvernnhqtel
    evprtprtp