| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily) beta(3)-alpha(3); meander and up-and-down bundle |
Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) ![]() |
| Family d.54.1.1: Enolase N-terminal domain-like [54827] (15 proteins) C-terminal domain is beta/alpha-barrel |
| Protein N-acylamino acid racemase [110937] (4 species) |
| Species Deinococcus radiodurans [TaxId:1299] [110939] (5 PDB entries) Uniprot Q9RYA6 |
| Domain d1xpyc2: 1xpy C:6-132 [115815] Other proteins in same PDB: d1xpya1, d1xpyb1, d1xpyc1, d1xpyd1 complexed with mg, nlq |
PDB Entry: 1xpy (more details), 2.3 Å
SCOPe Domain Sequences for d1xpyc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xpyc2 d.54.1.1 (C:6-132) N-acylamino acid racemase {Deinococcus radiodurans [TaxId: 1299]}
rmfkieaaeivvarlplkfrfetsfgvqthkvvpllilhgegvqgvaegtmearpmyree
tiagaldllrgtflpailgqtfanpeavsdalgsyrgnrmaramvemaawdlwartlgvp
lgtllgg
Timeline for d1xpyc2: