Lineage for d1xpyc2 (1xpy C:6-132)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2947581Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
    beta(3)-alpha(3); meander and up-and-down bundle
  4. 2947582Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) (S)
  5. 2947583Family d.54.1.1: Enolase N-terminal domain-like [54827] (15 proteins)
    C-terminal domain is beta/alpha-barrel
  6. 2947805Protein N-acylamino acid racemase [110937] (4 species)
  7. 2947823Species Deinococcus radiodurans [TaxId:1299] [110939] (5 PDB entries)
    Uniprot Q9RYA6
  8. 2947838Domain d1xpyc2: 1xpy C:6-132 [115815]
    Other proteins in same PDB: d1xpya1, d1xpyb1, d1xpyc1, d1xpyd1
    complexed with mg, nlq

Details for d1xpyc2

PDB Entry: 1xpy (more details), 2.3 Å

PDB Description: Structural Basis for Catalytic Racemization and Substrate Specificity of an N-Acylamino Acid Racemase Homologue from Deinococcus radiodurans
PDB Compounds: (C:) N-acylamino acid racemase

SCOPe Domain Sequences for d1xpyc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xpyc2 d.54.1.1 (C:6-132) N-acylamino acid racemase {Deinococcus radiodurans [TaxId: 1299]}
rmfkieaaeivvarlplkfrfetsfgvqthkvvpllilhgegvqgvaegtmearpmyree
tiagaldllrgtflpailgqtfanpeavsdalgsyrgnrmaramvemaawdlwartlgvp
lgtllgg

SCOPe Domain Coordinates for d1xpyc2:

Click to download the PDB-style file with coordinates for d1xpyc2.
(The format of our PDB-style files is described here.)

Timeline for d1xpyc2: