Lineage for d1xpyb1 (1xpy B:133-375)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2836768Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families) (S)
    binds metal ion (magnesium or manganese) in conserved site inside barrel
    N-terminal alpha+beta domain is common to this superfamily
  5. 2836928Family c.1.11.2: D-glucarate dehydratase-like [51609] (15 proteins)
  6. 2837049Protein N-acylamino acid racemase [110372] (4 species)
  7. 2837067Species Deinococcus radiodurans [TaxId:1299] [110374] (5 PDB entries)
    Uniprot Q9RYA6
  8. 2837081Domain d1xpyb1: 1xpy B:133-375 [115812]
    Other proteins in same PDB: d1xpya2, d1xpyb2, d1xpyc2, d1xpyd2
    complexed with mg, nlq

Details for d1xpyb1

PDB Entry: 1xpy (more details), 2.3 Å

PDB Description: Structural Basis for Catalytic Racemization and Substrate Specificity of an N-Acylamino Acid Racemase Homologue from Deinococcus radiodurans
PDB Compounds: (B:) N-acylamino acid racemase

SCOPe Domain Sequences for d1xpyb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xpyb1 c.1.11.2 (B:133-375) N-acylamino acid racemase {Deinococcus radiodurans [TaxId: 1299]}
hkeqvevgvslgiqadeqatvdlvrrhveqgyrriklkikpgwdvqpvratreafpdirl
tvdansaytladagrlrqldeydltyieqplawddlvdhaelarrirtplcldesvasas
darkalalgaggvinlkvarvgghaesrrvhdvaqsfgapvwcggmlesgigrahnihls
tlsnfrlpgdtssasrywerdliqepleavdglmpvpqgpgtgvtldreflatvteaqee
hra

SCOPe Domain Coordinates for d1xpyb1:

Click to download the PDB-style file with coordinates for d1xpyb1.
(The format of our PDB-style files is described here.)

Timeline for d1xpyb1: