SCOPe 2.08: Domain d1xpyd1: 1xpy D:133-375

Lineage for d1xpyd1 (1xpy D:133-375)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families)
   binds metal ion (magnesium or manganese) in conserved site inside barrel
   N-terminal alpha+beta domain is common to this superfamily

5. Family c.1.11.2: D-glucarate dehydratase-like [51609] (15 proteins)

6. Protein N-acylamino acid racemase [110372] (4 species)

7. Species Deinococcus radiodurans [TaxId:1299] [110374] (5 PDB entries)
   Uniprot Q9RYA6

8. Domain d1xpyd1: 1xpy D:133-375 [115816]
   Other proteins in same PDB: d1xpya2, d1xpyb2, d1xpyc2, d1xpyd2
   complexed with mg, nlq

Details for d1xpyd1

PDB Entry: 1xpy, 2.3 Å

PDB Description: Structural Basis for Catalytic Racemization and Substrate Specificity of an N-Acylamino Acid Racemase Homologue from Deinococcus radiodurans

PDB Compounds: (D:) N-acylamino acid racemase

SCOPe Domain Sequences for d1xpyd1:

Sequence; same for both SEQRES and ATOM records:

>d1xpyd1 c.1.11.2 (D:133-375) N-acylamino acid racemase {Deinococcus radiodurans [TaxId: 1299]}
hkeqvevgvslgiqadeqatvdlvrrhveqgyrriklkikpgwdvqpvratreafpdirl
tvdansaytladagrlrqldeydltyieqplawddlvdhaelarrirtplcldesvasas
darkalalgaggvinlkvarvgghaesrrvhdvaqsfgapvwcggmlesgigrahnihls
tlsnfrlpgdtssasrywerdliqepleavdglmpvpqgpgtgvtldreflatvteaqee
hra

Timeline for d1xpyd1:

• d1xpyd1 first appeared in SCOP 1.71
  
• d1xpyd1 appears in SCOPe 2.07