| Class b: All beta proteins [48724] (180 folds) |
| Fold b.40: OB-fold [50198] (17 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families) ![]() |
| Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (36 proteins) barrel, closed; n=5, S=8 |
| Protein Rho termination factor, RNA-binding domain [68910] (1 species) |
| Species Escherichia coli [TaxId:562] [68911] (9 PDB entries) Uniprot P03002 |
| Domain d1xprc2: 1xpr C:48-126 [115779] Other proteins in same PDB: d1xpra1, d1xpra3, d1xprb1, d1xprb3, d1xprc1, d1xprc3, d1xprd1, d1xprd3, d1xpre1, d1xpre3, d1xprf1, d1xprf3 protein/RNA complex; complexed with ags, fb, mg |
PDB Entry: 1xpr (more details), 3.15 Å
SCOPe Domain Sequences for d1xprc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xprc2 b.40.4.5 (C:48-126) Rho termination factor, RNA-binding domain {Escherichia coli [TaxId: 562]}
difgdgvleilqdgfgflrsadssylagpddiyvspsqirrfnlrtgdtisgkirppkeg
eryfallkvnevnfdkpen
Timeline for d1xprc2: