Lineage for d1xprb2 (1xpr B:48-126)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.40: OB-fold [50198] (17 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families) (S)
  5. Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (36 proteins)
    barrel, closed; n=5, S=8
  6. Protein Rho termination factor, RNA-binding domain [68910] (1 species)
  7. Species Escherichia coli [TaxId:562] [68911] (9 PDB entries)
    Uniprot P03002
  8. Domain d1xprb2: 1xpr B:48-126 [115776]
    Other proteins in same PDB: d1xpra1, d1xpra3, d1xprb1, d1xprb3, d1xprc1, d1xprc3, d1xprd1, d1xprd3, d1xpre1, d1xpre3, d1xprf1, d1xprf3
    protein/RNA complex; complexed with ags, fb, mg

Details for d1xprb2

PDB Entry: 1xpr (more details), 3.15 Å

PDB Description: Structural mechanism of inhibition of the Rho transcription termination factor by the antibiotic 5a-formylbicyclomycin (FB)
PDB Compounds: (B:) Rho transcription termination factor

SCOPe Domain Sequences for d1xprb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xprb2 b.40.4.5 (B:48-126) Rho termination factor, RNA-binding domain {Escherichia coli [TaxId: 562]}
difgdgvleilqdgfgflrsadssylagpddiyvspsqirrfnlrtgdtisgkirppkeg
eryfallkvnevnfdkpen

SCOPe Domain Coordinates for d1xprb2 are not available.

Timeline for d1xprb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1xprb1, d1xprb3
View in 3D
Domains from other chains:
(mouse over for more information)
d1xpra1, d1xpra2, d1xpra3, d1xprc1, d1xprc2, d1xprc3, d1xprd1, d1xprd2, d1xprd3, d1xpre1, d1xpre2, d1xpre3, d1xprf1, d1xprf2, d1xprf3