Lineage for d1xp4d1 (1xp4 D:294-386)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2820866Fold b.105: Penicillin-binding protein associated domain [69188] (1 superfamily)
    sandwich; 6 strands in 2 sheets
  4. 2820867Superfamily b.105.1: Penicillin-binding protein associated domain [69189] (3 families) (S)
  5. 2820868Family b.105.1.1: PBP5 C-terminal domain-like [69190] (2 proteins)
    automatically mapped to Pfam PF07943
  6. 2820869Protein D,D-carboxypeptidase DacA, C-terminal domain [117078] (1 species)
  7. 2820870Species Pneumococcus (Streptococcus pneumoniae) [TaxId:1313] [117079] (1 PDB entry)
    Uniprot P72518 25-393
  8. 2820874Domain d1xp4d1: 1xp4 D:294-386 [115728]
    Other proteins in same PDB: d1xp4a2, d1xp4b2, d1xp4c2, d1xp4d2
    complexed with iod, so4
    fragment; missing more than one-third of the common structure and/or sequence

Details for d1xp4d1

PDB Entry: 1xp4 (more details), 2.8 Å

PDB Description: Crystal structure of a peptidoglycan synthesis regulatory factor (PBP3) from Streptococcus pneumoniae
PDB Compounds: (D:) d-alanyl-d-alanine carboxypeptidase

SCOPe Domain Sequences for d1xp4d1:

Sequence, based on SEQRES records: (download)

>d1xp4d1 b.105.1.1 (D:294-386) D,D-carboxypeptidase DacA, C-terminal domain {Pneumococcus (Streptococcus pneumoniae) [TaxId: 1313]}
tlrkivqqgdayqdskapvqdgkedtviavapediyliervgnqssqsvqftpdskaipa
pleagtvvghltyedkdligqgyitterpsfem

Sequence, based on observed residues (ATOM records): (download)

>d1xp4d1 b.105.1.1 (D:294-386) D,D-carboxypeptidase DacA, C-terminal domain {Pneumococcus (Streptococcus pneumoniae) [TaxId: 1313]}
tlrkivqqgdayqdskavapediyliervqsvqftpdhltyedkdligqgyitterpsfe
m

SCOPe Domain Coordinates for d1xp4d1:

Click to download the PDB-style file with coordinates for d1xp4d1.
(The format of our PDB-style files is described here.)

Timeline for d1xp4d1: