![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.105: Penicillin-binding protein associated domain [69188] (1 superfamily) sandwich; 6 strands in 2 sheets |
![]() | Superfamily b.105.1: Penicillin-binding protein associated domain [69189] (3 families) ![]() |
![]() | Family b.105.1.1: PBP5 C-terminal domain-like [69190] (2 proteins) automatically mapped to Pfam PF07943 |
![]() | Protein D,D-carboxypeptidase DacA, C-terminal domain [117078] (1 species) |
![]() | Species Pneumococcus (Streptococcus pneumoniae) [TaxId:1313] [117079] (1 PDB entry) Uniprot P72518 25-393 |
![]() | Domain d1xp4d1: 1xp4 D:294-386 [115728] Other proteins in same PDB: d1xp4a2, d1xp4b2, d1xp4c2, d1xp4d2 complexed with iod, so4 fragment; missing more than one-third of the common structure and/or sequence |
PDB Entry: 1xp4 (more details), 2.8 Å
SCOPe Domain Sequences for d1xp4d1:
Sequence, based on SEQRES records: (download)
>d1xp4d1 b.105.1.1 (D:294-386) D,D-carboxypeptidase DacA, C-terminal domain {Pneumococcus (Streptococcus pneumoniae) [TaxId: 1313]} tlrkivqqgdayqdskapvqdgkedtviavapediyliervgnqssqsvqftpdskaipa pleagtvvghltyedkdligqgyitterpsfem
>d1xp4d1 b.105.1.1 (D:294-386) D,D-carboxypeptidase DacA, C-terminal domain {Pneumococcus (Streptococcus pneumoniae) [TaxId: 1313]} tlrkivqqgdayqdskavapediyliervqsvqftpdhltyedkdligqgyitterpsfe m
Timeline for d1xp4d1: