PDB entry 1xp4

View 1xp4 on RCSB PDB site
Description: Crystal structure of a peptidoglycan synthesis regulatory factor (PBP3) from Streptococcus pneumoniae
Class: hydrolase
Keywords: five-stranded antiparallel beta-sheet, omega-like loop, HYDROLASE
Deposited on 2004-10-08, released 2004-11-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.237
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: d-alanyl-d-alanine carboxypeptidase
    Species: Streptococcus pneumoniae [TaxId:171101]
    Gene: DACA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8DQ99
      • modified residue (85)
      • modified residue (125-126)
      • modified residue (200)
      • modified residue (208)
      • modified residue (212)
      • modified residue (243)
      • modified residue (270)
      • modified residue (370)
    Domains in SCOPe 2.07: d1xp4a1, d1xp4a2
  • Chain 'B':
    Compound: d-alanyl-d-alanine carboxypeptidase
    Species: Streptococcus pneumoniae [TaxId:171101]
    Gene: DACA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8DQ99
      • modified residue (85)
      • modified residue (125-126)
      • modified residue (200)
      • modified residue (208)
      • modified residue (212)
      • modified residue (243)
      • modified residue (270)
      • modified residue (370)
    Domains in SCOPe 2.07: d1xp4b1, d1xp4b2
  • Chain 'C':
    Compound: d-alanyl-d-alanine carboxypeptidase
    Species: Streptococcus pneumoniae [TaxId:171101]
    Gene: DACA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8DQ99
      • modified residue (85)
      • modified residue (125-126)
      • modified residue (200)
      • modified residue (208)
      • modified residue (212)
      • modified residue (243)
      • modified residue (270)
      • modified residue (370)
    Domains in SCOPe 2.07: d1xp4c1, d1xp4c2
  • Chain 'D':
    Compound: d-alanyl-d-alanine carboxypeptidase
    Species: Streptococcus pneumoniae [TaxId:171101]
    Gene: DACA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8DQ99
      • modified residue (85)
      • modified residue (125-126)
      • modified residue (200)
      • modified residue (208)
      • modified residue (212)
      • modified residue (243)
      • modified residue (270)
      • modified residue (370)
    Domains in SCOPe 2.07: d1xp4d1, d1xp4d2
  • Heterogens: SO4, IOD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xp4A (A:)
    gvstavaqdftiaakhaiaveantgkilyekdatqpveiasitklitvylvyealengsi
    tlstpvdisdypyqlttnseasnipmearnytveelleatlvssansaaialaekiagse
    kdfvdmmrakllewgiqdatvvnttglnnetlgdniypgskkdeenklsaydvaivarnl
    ikkypqvleitkkpsstfagmtitstnymlegmpayrggfdglktgttdkagesfvgttv
    ekgmrvitvvlnadhqdnnpyarftatsslmdyisstftlrkivqqgdayqdskapvqdg
    kedtviavapediyliervgnqssqsvqftpdskaipapleagtvvghltyedkdligqg
    yitterpsfemvadkkiek
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xp4A (A:)
    ftiaakhaiaveantgkilyekdatqpveiasitklitvylvyealengsitlstpvdis
    dypyqlttnseasnipmearnytveelleatlvssansaaialaekiagsekdfvdmmra
    kllewgiqdatvvnttglnnetlgdniypgskkdeenklsaydvaivarnlikkypqvle
    itkkpsstfagmtitstnymlegmpayrggfdglktgttdkagesfvgttvekgmrvitv
    vlnadhqdnnpyarftatsslmdyisstftlrkivqqgdayqdskapvqdgkedtviava
    pediyliervgnqssqsvqftpdskaipapleagtvvghltyedkdligqgyitterpsf
    emvadkkie
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1xp4B (B:)
    gvstavaqdftiaakhaiaveantgkilyekdatqpveiasitklitvylvyealengsi
    tlstpvdisdypyqlttnseasnipmearnytveelleatlvssansaaialaekiagse
    kdfvdmmrakllewgiqdatvvnttglnnetlgdniypgskkdeenklsaydvaivarnl
    ikkypqvleitkkpsstfagmtitstnymlegmpayrggfdglktgttdkagesfvgttv
    ekgmrvitvvlnadhqdnnpyarftatsslmdyisstftlrkivqqgdayqdskapvqdg
    kedtviavapediyliervgnqssqsvqftpdskaipapleagtvvghltyedkdligqg
    yitterpsfemvadkkiek
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xp4B (B:)
    ftiaakhaiaveantgkilyekdatqpveiasitklitvylvyealengsitlstpvdis
    dypyqlttnseasnipmearnytveelleatlvssansaaialaekiagsekdfvdmmra
    kllewgiqdatvvnttglnnetlgdniypgskkdeenklsaydvaivarnlikkypqvle
    itkkpsstfagmtitstnymlegmpayrggfdglktgttdkagesfvgttvekgmrvitv
    vlnadhpyarftatsslmdyisstftlrkivqqgdayqdsiavapediyliervgnqssq
    svqftpdvvghltyedkdligqgyitterpsfemvadkk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1xp4C (C:)
    gvstavaqdftiaakhaiaveantgkilyekdatqpveiasitklitvylvyealengsi
    tlstpvdisdypyqlttnseasnipmearnytveelleatlvssansaaialaekiagse
    kdfvdmmrakllewgiqdatvvnttglnnetlgdniypgskkdeenklsaydvaivarnl
    ikkypqvleitkkpsstfagmtitstnymlegmpayrggfdglktgttdkagesfvgttv
    ekgmrvitvvlnadhqdnnpyarftatsslmdyisstftlrkivqqgdayqdskapvqdg
    kedtviavapediyliervgnqssqsvqftpdskaipapleagtvvghltyedkdligqg
    yitterpsfemvadkkiek
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xp4C (C:)
    ftiaakhaiaveantgkilyekdatqpveiasitklitvylvyealengsitlstpvdis
    dypyqlttnseasnipmearnytveelleatlvssansaaialaekiagsekdfvdmmra
    kllewgiqdatvvnttglnnetlgdniypgskkdeenklsaydvaivarnlikkypqvle
    itkkpsstfagmtitstnymlegmpayrggfdglktgttdkagesfvgttvekgmrvitv
    vlnadhqdnnpyarftatsslmdyisstftlrkivqqgdayqdskapvqdgkedtviava
    pediyliervgnqsvqftpdsleagtvvghltyedkdligqgyitterpsfemvadkki
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1xp4D (D:)
    gvstavaqdftiaakhaiaveantgkilyekdatqpveiasitklitvylvyealengsi
    tlstpvdisdypyqlttnseasnipmearnytveelleatlvssansaaialaekiagse
    kdfvdmmrakllewgiqdatvvnttglnnetlgdniypgskkdeenklsaydvaivarnl
    ikkypqvleitkkpsstfagmtitstnymlegmpayrggfdglktgttdkagesfvgttv
    ekgmrvitvvlnadhqdnnpyarftatsslmdyisstftlrkivqqgdayqdskapvqdg
    kedtviavapediyliervgnqssqsvqftpdskaipapleagtvvghltyedkdligqg
    yitterpsfemvadkkiek
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xp4D (D:)
    ftiaakhaiaveantgkilyekdatqpveiasitklitvylvyealengsitlstpvdis
    dypyqlttnipmearnytveelleatlvssansaaialaekiagsekdfvdmmrakllew
    giqdatvvnttglnnetlgdniypgskkdeenklsaydvaivarnlikkypqvleitkkp
    sstfagmtitstnymlegmpayrggfdglktgttdkagesfvgttvekgmrvitvvlnad
    hpyarftatsslmdyisstftlrkivqqgdayqdskavapediyliervqsvqftpdhlt
    yedkdligqgyitterpsfem