SCOPe 2.08: Domain d1xp4c2: 1xp4 C:25-293

Lineage for d1xp4c2 (1xp4 C:25-293)

1. Root: SCOPe 2.08

2. Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)

3. Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
   contains a cluster of helices and an alpha+beta sandwich

4. Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families)

5. Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)
   in the multi-domain class (e), this applies to domains with different numbers of (sub)domains than the most common domain
   

6. Protein D,D-carboxypeptidase DacA, N-terminal domain [118181] (1 species)

7. Species Pneumococcus (Streptococcus pneumoniae) [TaxId:1313] [118182] (1 PDB entry)
   Uniprot P72518 25-393

8. Domain d1xp4c2: 1xp4 C:25-293 [115727]
   Other proteins in same PDB: d1xp4a1, d1xp4b1, d1xp4c1, d1xp4d1
   complexed with iod, so4

Details for d1xp4c2

PDB Entry: 1xp4, 2.8 Å

PDB Description: Crystal structure of a peptidoglycan synthesis regulatory factor (PBP3) from Streptococcus pneumoniae

PDB Compounds: (C:) d-alanyl-d-alanine carboxypeptidase

SCOPe Domain Sequences for d1xp4c2:

Sequence; same for both SEQRES and ATOM records:

>d1xp4c2 e.3.1.1 (C:25-293) D,D-carboxypeptidase DacA, N-terminal domain {Pneumococcus (Streptococcus pneumoniae) [TaxId: 1313]}
ftiaakhaiaveantgkilyekdatqpveiasitklitvylvyealengsitlstpvdis
dypyqlttnseasnipmearnytveelleatlvssansaaialaekiagsekdfvdmmra
kllewgiqdatvvnttglnnetlgdniypgskkdeenklsaydvaivarnlikkypqvle
itkkpsstfagmtitstnymlegmpayrggfdglktgttdkagesfvgttvekgmrvitv
vlnadhqdnnpyarftatsslmdyisstf

Timeline for d1xp4c2:

• d1xp4c2 first appeared in SCOP 1.71
  
• d1xp4c2 appears in SCOPe 2.07