Lineage for d1xp4a2 (1xp4 A:25-293)

  1. Root: SCOPe 2.08
  2. 3012399Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)
  3. 3012718Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 3012719Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. 3012720Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)
    in the multi-domain class (e), this applies to domains with different numbers of (sub)domains than the most common domain
  6. 3013393Protein D,D-carboxypeptidase DacA, N-terminal domain [118181] (1 species)
  7. 3013394Species Pneumococcus (Streptococcus pneumoniae) [TaxId:1313] [118182] (1 PDB entry)
    Uniprot P72518 25-393
  8. 3013395Domain d1xp4a2: 1xp4 A:25-293 [115723]
    Other proteins in same PDB: d1xp4a1, d1xp4b1, d1xp4c1, d1xp4d1
    complexed with iod, so4

Details for d1xp4a2

PDB Entry: 1xp4 (more details), 2.8 Å

PDB Description: Crystal structure of a peptidoglycan synthesis regulatory factor (PBP3) from Streptococcus pneumoniae
PDB Compounds: (A:) d-alanyl-d-alanine carboxypeptidase

SCOPe Domain Sequences for d1xp4a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xp4a2 e.3.1.1 (A:25-293) D,D-carboxypeptidase DacA, N-terminal domain {Pneumococcus (Streptococcus pneumoniae) [TaxId: 1313]}
ftiaakhaiaveantgkilyekdatqpveiasitklitvylvyealengsitlstpvdis
dypyqlttnseasnipmearnytveelleatlvssansaaialaekiagsekdfvdmmra
kllewgiqdatvvnttglnnetlgdniypgskkdeenklsaydvaivarnlikkypqvle
itkkpsstfagmtitstnymlegmpayrggfdglktgttdkagesfvgttvekgmrvitv
vlnadhqdnnpyarftatsslmdyisstf

SCOPe Domain Coordinates for d1xp4a2:

Click to download the PDB-style file with coordinates for d1xp4a2.
(The format of our PDB-style files is described here.)

Timeline for d1xp4a2: