![]() | Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds) |
![]() | Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily) contains a cluster of helices and an alpha+beta sandwich |
![]() | Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) ![]() |
![]() | Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins) in the multi-domain class (e), this applies to domains with different numbers of (sub)domains than the most common domain |
![]() | Protein D,D-carboxypeptidase DacA, N-terminal domain [118181] (1 species) |
![]() | Species Pneumococcus (Streptococcus pneumoniae) [TaxId:1313] [118182] (1 PDB entry) Uniprot P72518 25-393 |
![]() | Domain d1xp4a2: 1xp4 A:25-293 [115723] Other proteins in same PDB: d1xp4a1, d1xp4b1, d1xp4c1, d1xp4d1 complexed with iod, so4 |
PDB Entry: 1xp4 (more details), 2.8 Å
SCOPe Domain Sequences for d1xp4a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xp4a2 e.3.1.1 (A:25-293) D,D-carboxypeptidase DacA, N-terminal domain {Pneumococcus (Streptococcus pneumoniae) [TaxId: 1313]} ftiaakhaiaveantgkilyekdatqpveiasitklitvylvyealengsitlstpvdis dypyqlttnseasnipmearnytveelleatlvssansaaialaekiagsekdfvdmmra kllewgiqdatvvnttglnnetlgdniypgskkdeenklsaydvaivarnlikkypqvle itkkpsstfagmtitstnymlegmpayrggfdglktgttdkagesfvgttvekgmrvitv vlnadhqdnnpyarftatsslmdyisstf
Timeline for d1xp4a2: