SCOPe 2.06: Domain d1xn6a_: 1xn6 A:

Lineage for d1xn6a_ (1xn6 A:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.129: TBP-like [55944] (11 superfamilies)
   beta-alpha-beta(4)-alpha

4. Superfamily d.129.3: Bet v1-like [55961] (11 families)
   contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix

5. Family d.129.3.5: AHSA1 domain [111168] (12 proteins)
   Pfam PF05146

6. Protein Hypothetical protein BC4709 [118099] (1 species)

7. Species Bacillus cereus [TaxId:1396] [118100] (1 PDB entry)
   Uniprot Q816V6

8. Domain d1xn6a_: 1xn6 A: [115575]
   Structural genomics target

Details for d1xn6a_

PDB Entry: 1xn6

PDB Description: solution structure of northeast structural genomics target protein bcr68 encoded in gene q816v6 of b. cereus

PDB Compounds: (A:) hypothetical protein BC4709

SCOPe Domain Sequences for d1xn6a_:

Sequence; same for both SEQRES and ATOM records:

>d1xn6a_ d.129.3.5 (A:) Hypothetical protein BC4709 {Bacillus cereus [TaxId: 1396]}
meqqntlndikqtivfnasiqkvwsvvstaegiaswfmpndfvlevghefhvqspfgpsp
ckvleidepnhlsfswdtdgwvvsfdlkdlgdnkteftlihggwkhpdeilpkanakssi
irdrmsggwvaivneklkkvveg

Timeline for d1xn6a_:

• d1xn6a_ first appeared in SCOP 1.71
  
• d1xn6a_ appears in SCOPe 2.05
  
• d1xn6a_ appears in SCOPe 2.07
  
• d1xn6a_ appears in the current release, SCOPe 2.08