Lineage for d1xn6a_ (1xn6 A:)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 610723Fold d.129: TBP-like [55944] (9 superfamilies)
    beta-alpha-beta(4)-alpha
  4. 610890Superfamily d.129.3: Bet v1-like [55961] (6 families) (S)
    contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix
  5. 610965Family d.129.3.5: Aha1 domain [111168] (4 proteins)
    Pfam 05146
  6. 610966Protein Hypothetical protein BC4709 [118099] (1 species)
  7. 610967Species Bacillus cereus [TaxId:1396] [118100] (1 PDB entry)
  8. 610968Domain d1xn6a_: 1xn6 A: [115575]
    Structural genomics target

Details for d1xn6a_

PDB Entry: 1xn6 (more details)

PDB Description: Solution Structure of Northeast Structural Genomics Target Protein BcR68 encoded in gene Q816V6 of B. cereus

SCOP Domain Sequences for d1xn6a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xn6a_ d.129.3.5 (A:) Hypothetical protein BC4709 {Bacillus cereus}
meqqntlndikqtivfnasiqkvwsvvstaegiaswfmpndfvlevghefhvqspfgpsp
ckvleidepnhlsfswdtdgwvvsfdlkdlgdnkteftlihggwkhpdeilpkanakssi
irdrmsggwvaivneklkkvveg

SCOP Domain Coordinates for d1xn6a_:

Click to download the PDB-style file with coordinates for d1xn6a_.
(The format of our PDB-style files is described here.)

Timeline for d1xn6a_: