Lineage for d1xn6a_ (1xn6 A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2975208Fold d.129: TBP-like [55944] (11 superfamilies)
    beta-alpha-beta(4)-alpha
  4. 2975504Superfamily d.129.3: Bet v1-like [55961] (11 families) (S)
    contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix
  5. 2975805Family d.129.3.5: AHSA1 domain [111168] (12 proteins)
    Pfam PF05146
  6. 2975815Protein Hypothetical protein BC4709 [118099] (1 species)
  7. 2975816Species Bacillus cereus [TaxId:1396] [118100] (1 PDB entry)
    Uniprot Q816V6
  8. 2975817Domain d1xn6a_: 1xn6 A: [115575]
    Structural genomics target

Details for d1xn6a_

PDB Entry: 1xn6 (more details)

PDB Description: solution structure of northeast structural genomics target protein bcr68 encoded in gene q816v6 of b. cereus
PDB Compounds: (A:) hypothetical protein BC4709

SCOPe Domain Sequences for d1xn6a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xn6a_ d.129.3.5 (A:) Hypothetical protein BC4709 {Bacillus cereus [TaxId: 1396]}
meqqntlndikqtivfnasiqkvwsvvstaegiaswfmpndfvlevghefhvqspfgpsp
ckvleidepnhlsfswdtdgwvvsfdlkdlgdnkteftlihggwkhpdeilpkanakssi
irdrmsggwvaivneklkkvveg

SCOPe Domain Coordinates for d1xn6a_:

Click to download the PDB-style file with coordinates for d1xn6a_.
(The format of our PDB-style files is described here.)

Timeline for d1xn6a_: