PDB entry 1xn6

View 1xn6 on RCSB PDB site
Description: Solution Structure of Northeast Structural Genomics Target Protein BcR68 encoded in gene Q816V6 of B. cereus
Class: structural genomics, unknown function
Keywords: Structural genomics, Protein Structure Initiative, PSI, NESG Target Protein BcR68, alpha + beta, GFT NMR, Northeast Structural Genomics Consortium, NESG, UNKNOWN FUNCTION
Deposited on 2004-10-04, released 2004-12-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypothetical protein BC4709
    Species: Bacillus cereus [TaxId:1396]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1xn6a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1xn6A (A:)
    meqqntlndikqtivfnasiqkvwsvvstaegiaswfmpndfvlevghefhvqspfgpsp
    ckvleidepnhlsfswdtdgwvvsfdlkdlgdnkteftlihggwkhpdeilpkanakssi
    irdrmsggwvaivneklkkvveg