Class c: Alpha and beta proteins (a/b) [51349] (134 folds) |
Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.8: N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) [52255] (1 family) |
Family c.23.8.1: N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) [52256] (1 protein) |
Protein N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) [52257] (4 species) |
Species Bacillus anthracis [TaxId:1392] [117479] (1 PDB entry) |
Domain d1xmpg_: 1xmp G: [115527] |
PDB Entry: 1xmp (more details), 1.8 Å
SCOP Domain Sequences for d1xmpg_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xmpg_ c.23.8.1 (G:) N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) {Bacillus anthracis} sshhhhhhmkslvgvimgstsdwetmkyacdildelnipyekkvvsahrtpdymfeyaet arerglkviiagaggaahlpgmvaaktnlpvigvpvqskalngldsllsivqmpggvpva tvaigkagstnagllaaqilgsfhddihdalelrreaiekdvre
Timeline for d1xmpg_: