PDB entry 1xmp

View 1xmp on RCSB PDB site
Description: Crystal Structure of PurE (BA0288) from Bacillus anthracis at 1.8 Resolution
Deposited on 2004-10-04, released 2004-11-16
The last revision prior to the SCOP 1.71 freeze date was dated 2004-11-16, with a file datestamp of 2004-11-16.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.169
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1xmpa_
  • Chain 'B':
    Domains in SCOP 1.71: d1xmpb_
  • Chain 'C':
    Domains in SCOP 1.71: d1xmpc_
  • Chain 'D':
    Domains in SCOP 1.71: d1xmpd_
  • Chain 'E':
    Domains in SCOP 1.71: d1xmpe_
  • Chain 'F':
    Domains in SCOP 1.71: d1xmpf_
  • Chain 'G':
    Domains in SCOP 1.71: d1xmpg_
  • Chain 'H':
    Domains in SCOP 1.71: d1xmph_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xmpA (A:)
    gsshhhhhhmkslvgvimgstsdwetmkyacdildelnipyekkvvsahrtpdymfeyae
    tarerglkviiagaggaahlpgmvaaktnlpvigvpvqskalngldsllsivqmpggvpv
    atvaigkagstnagllaaqilgsfhddihdalelrreaiekdvregselv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xmpA (A:)
    kslvgvimgstsdwetmkyacdildelnipyekkvvsahrtpdymfeyaetarerglkvi
    iagaggaahlpgmvaaktnlpvigvpvqskalngldsllsivqmpggvpvatvaigkags
    tnagllaaqilgsfhddihdalelrreaiekdvre
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1xmpB (B:)
    gsshhhhhhmkslvgvimgstsdwetmkyacdildelnipyekkvvsahrtpdymfeyae
    tarerglkviiagaggaahlpgmvaaktnlpvigvpvqskalngldsllsivqmpggvpv
    atvaigkagstnagllaaqilgsfhddihdalelrreaiekdvregselv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xmpB (B:)
    kslvgvimgstsdwetmkyacdildelnipyekkvvsahrtpdymfeyaetarerglkvi
    iagaggaahlpgmvaaktnlpvigvpvqskalngldsllsivqmpggvpvatvaigkags
    tnagllaaqilgsfhddihdalelrreaiekdvregs
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1xmpC (C:)
    gsshhhhhhmkslvgvimgstsdwetmkyacdildelnipyekkvvsahrtpdymfeyae
    tarerglkviiagaggaahlpgmvaaktnlpvigvpvqskalngldsllsivqmpggvpv
    atvaigkagstnagllaaqilgsfhddihdalelrreaiekdvregselv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xmpC (C:)
    sshhhhhhmkslvgvimgstsdwetmkyacdildelnipyekkvvsahrtpdymfeyaet
    arerglkviiagaggaahlpgmvaaktnlpvigvpvqskalngldsllsivqmpggvpva
    tvaigkagstnagllaaqilgsfhddihdalelrreaiekdvre
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1xmpD (D:)
    gsshhhhhhmkslvgvimgstsdwetmkyacdildelnipyekkvvsahrtpdymfeyae
    tarerglkviiagaggaahlpgmvaaktnlpvigvpvqskalngldsllsivqmpggvpv
    atvaigkagstnagllaaqilgsfhddihdalelrreaiekdvregselv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xmpD (D:)
    kslvgvimgstsdwetmkyacdildelnipyekkvvsahrtpdymfeyaetarerglkvi
    iagaggaahlpgmvaaktnlpvigvpvqskalngldsllsivqmpggvpvatvaigkags
    tnagllaaqilgsfhddihdalelrreaiekdvre
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1xmpE (E:)
    gsshhhhhhmkslvgvimgstsdwetmkyacdildelnipyekkvvsahrtpdymfeyae
    tarerglkviiagaggaahlpgmvaaktnlpvigvpvqskalngldsllsivqmpggvpv
    atvaigkagstnagllaaqilgsfhddihdalelrreaiekdvregselv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xmpE (E:)
    kslvgvimgstsdwetmkyacdildelnipyekkvvsahrtpdymfeyaetarerglkvi
    iagaggaahlpgmvaaktnlpvigvpvqskalngldsllsivqmpggvpvatvaigkags
    tnagllaaqilgsfhddihdalelrreaiekdvre
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1xmpF (F:)
    gsshhhhhhmkslvgvimgstsdwetmkyacdildelnipyekkvvsahrtpdymfeyae
    tarerglkviiagaggaahlpgmvaaktnlpvigvpvqskalngldsllsivqmpggvpv
    atvaigkagstnagllaaqilgsfhddihdalelrreaiekdvregselv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xmpF (F:)
    kslvgvimgstsdwetmkyacdildelnipyekkvvsahrtpdymfeyaetarerglkvi
    iagaggaahlpgmvaaktnlpvigvpvqskalngldsllsivqmpggvpvatvaigkags
    tnagllaaqilgsfhddihdalelrreaiekdvregselv
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1xmpG (G:)
    gsshhhhhhmkslvgvimgstsdwetmkyacdildelnipyekkvvsahrtpdymfeyae
    tarerglkviiagaggaahlpgmvaaktnlpvigvpvqskalngldsllsivqmpggvpv
    atvaigkagstnagllaaqilgsfhddihdalelrreaiekdvregselv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xmpG (G:)
    sshhhhhhmkslvgvimgstsdwetmkyacdildelnipyekkvvsahrtpdymfeyaet
    arerglkviiagaggaahlpgmvaaktnlpvigvpvqskalngldsllsivqmpggvpva
    tvaigkagstnagllaaqilgsfhddihdalelrreaiekdvre
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1xmpH (H:)
    gsshhhhhhmkslvgvimgstsdwetmkyacdildelnipyekkvvsahrtpdymfeyae
    tarerglkviiagaggaahlpgmvaaktnlpvigvpvqskalngldsllsivqmpggvpv
    atvaigkagstnagllaaqilgsfhddihdalelrreaiekdvregselv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xmpH (H:)
    kslvgvimgstsdwetmkyacdildelnipyekkvvsahrtpdymfeyaetarerglkvi
    iagaggaahlpgmvaaktnlpvigvpvqskalngldsllsivqmpggvpvatvaigkags
    tnagllaaqilgsfhddihdalelrreaiekdvregselv