Lineage for d1xmpg_ (1xmp G:)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 691580Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 692273Superfamily c.23.8: N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) [52255] (1 family) (S)
  5. 692274Family c.23.8.1: N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) [52256] (1 protein)
  6. 692275Protein N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) [52257] (4 species)
  7. 692283Species Bacillus anthracis [TaxId:1392] [117479] (1 PDB entry)
  8. 692290Domain d1xmpg_: 1xmp G: [115527]

Details for d1xmpg_

PDB Entry: 1xmp (more details), 1.8 Å

PDB Description: Crystal Structure of PurE (BA0288) from Bacillus anthracis at 1.8 Resolution
PDB Compounds: (G:) phosphoribosylaminoimidazole carboxylase

SCOP Domain Sequences for d1xmpg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xmpg_ c.23.8.1 (G:) N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) {Bacillus anthracis [TaxId: 1392]}
sshhhhhhmkslvgvimgstsdwetmkyacdildelnipyekkvvsahrtpdymfeyaet
arerglkviiagaggaahlpgmvaaktnlpvigvpvqskalngldsllsivqmpggvpva
tvaigkagstnagllaaqilgsfhddihdalelrreaiekdvre

SCOP Domain Coordinates for d1xmpg_:

Click to download the PDB-style file with coordinates for d1xmpg_.
(The format of our PDB-style files is described here.)

Timeline for d1xmpg_: