Lineage for d1xmpe_ (1xmp E:)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 578575Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 579108Superfamily c.23.8: N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) [52255] (1 family) (S)
  5. 579109Family c.23.8.1: N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) [52256] (1 protein)
  6. 579110Protein N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) [52257] (4 species)
  7. 579114Species Bacillus anthracis [TaxId:1392] [117479] (1 PDB entry)
  8. 579119Domain d1xmpe_: 1xmp E: [115525]

Details for d1xmpe_

PDB Entry: 1xmp (more details), 1.8 Å

PDB Description: Crystal Structure of PurE (BA0288) from Bacillus anthracis at 1.8 Resolution

SCOP Domain Sequences for d1xmpe_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xmpe_ c.23.8.1 (E:) N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) {Bacillus anthracis}
kslvgvimgstsdwetmkyacdildelnipyekkvvsahrtpdymfeyaetarerglkvi
iagaggaahlpgmvaaktnlpvigvpvqskalngldsllsivqmpggvpvatvaigkags
tnagllaaqilgsfhddihdalelrreaiekdvre

SCOP Domain Coordinates for d1xmpe_:

Click to download the PDB-style file with coordinates for d1xmpe_.
(The format of our PDB-style files is described here.)

Timeline for d1xmpe_: