SCOPe 2.08: Domain d1xmba1: 1xmb A:37-215,A:335-428

Lineage for d1xmba1 (1xmb A:37-215,A:335-428)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
   core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops

4. Superfamily c.56.5: Zn-dependent exopeptidases [53187] (10 families)
   core: mixed beta-sheet of 8 strands, order 12435867; strands 2, 6 & 7 are antiparallel to the rest

5. Family c.56.5.4: Bacterial dinuclear zinc exopeptidases [53204] (18 proteins)

6. Protein IAA-amino acid hydrolase, catalytic domain [117663] (1 species)

7. Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [117664] (2 PDB entries)
   Uniprot P54970 37-428

8. Domain d1xmba1: 1xmb A:37-215,A:335-428 [115479]
   Other proteins in same PDB: d1xmba2
   structural genomics target

Details for d1xmba1

PDB Entry: 1xmb, 2 Å

PDB Description: x-ray structure of iaa-aminoacid hydrolase from arabidopsis thaliana gene at5g56660

PDB Compounds: (A:) IAA-amino acid hydrolase homolog 2

SCOPe Domain Sequences for d1xmba1:

Sequence; same for both SEQRES and ATOM records:

>d1xmba1 c.56.5.4 (A:37-215,A:335-428) IAA-amino acid hydrolase, catalytic domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
kllefakspevfdwmvkirrkihenpelgyeeletsklirseleligikyrypvaitgvi
gyigtgeppfvalradmdalpiqegvewehkskiagkmhacghdghvtmllgaakilheh
rhhlqgtvvlifqpaeeglsgakkmreegalknveaifgihlsaripfgkaasragsflX
tvnnkdlykqfkkvvrdllgqeafveaapvmgsedfsyfaetipghfsllgmqdetngya
sshsplyrinedvlpygaaihasmavqylkekas

Timeline for d1xmba1:

• d1xmba1 first appeared in SCOP 1.71
  
• d1xmba1 appears in SCOPe 2.07