Lineage for d1xmba2 (1xmb A:216-334)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2516578Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2521258Superfamily d.58.19: Bacterial exopeptidase dimerisation domain [55031] (1 family) (S)
  5. 2521259Family d.58.19.1: Bacterial exopeptidase dimerisation domain [55032] (8 proteins)
  6. 2521275Protein IAA-amino acid hydrolase [117979] (1 species)
    apparently monomeric
  7. 2521276Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [117980] (2 PDB entries)
    Uniprot P54970 37-428
  8. 2521278Domain d1xmba2: 1xmb A:216-334 [115480]
    Other proteins in same PDB: d1xmba1
    structural genomics target

Details for d1xmba2

PDB Entry: 1xmb (more details), 2 Å

PDB Description: x-ray structure of iaa-aminoacid hydrolase from arabidopsis thaliana gene at5g56660
PDB Compounds: (A:) IAA-amino acid hydrolase homolog 2

SCOPe Domain Sequences for d1xmba2:

Sequence, based on SEQRES records: (download)

>d1xmba2 d.58.19.1 (A:216-334) IAA-amino acid hydrolase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
agagvfeavitgkgghaaipqhtidpvvaassivlslqqlvsretdpldskvvtvskvng
gnafnvipdsitiggtlraftgftqlqqrvkevitkqaavhrcnasvnltpngrepmpp

Sequence, based on observed residues (ATOM records): (download)

>d1xmba2 d.58.19.1 (A:216-334) IAA-amino acid hydrolase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
agagvfeavitgktidpvvaassivlslqqlvsretdpldskvvtvskvnpdsitiggtl
raftgftqlqqrvkevitkqaavhrcnasvnltpngrepmpp

SCOPe Domain Coordinates for d1xmba2:

Click to download the PDB-style file with coordinates for d1xmba2.
(The format of our PDB-style files is described here.)

Timeline for d1xmba2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1xmba1