![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.19: Bacterial exopeptidase dimerisation domain [55031] (1 family) ![]() |
![]() | Family d.58.19.1: Bacterial exopeptidase dimerisation domain [55032] (8 proteins) |
![]() | Protein IAA-amino acid hydrolase [117979] (1 species) apparently monomeric |
![]() | Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [117980] (2 PDB entries) Uniprot P54970 37-428 |
![]() | Domain d1xmba2: 1xmb A:216-334 [115480] Other proteins in same PDB: d1xmba1 structural genomics target |
PDB Entry: 1xmb (more details), 2 Å
SCOPe Domain Sequences for d1xmba2:
Sequence, based on SEQRES records: (download)
>d1xmba2 d.58.19.1 (A:216-334) IAA-amino acid hydrolase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} agagvfeavitgkgghaaipqhtidpvvaassivlslqqlvsretdpldskvvtvskvng gnafnvipdsitiggtlraftgftqlqqrvkevitkqaavhrcnasvnltpngrepmpp
>d1xmba2 d.58.19.1 (A:216-334) IAA-amino acid hydrolase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} agagvfeavitgktidpvvaassivlslqqlvsretdpldskvvtvskvnpdsitiggtl raftgftqlqqrvkevitkqaavhrcnasvnltpngrepmpp
Timeline for d1xmba2: