PDB entry 1xmb

View 1xmb on RCSB PDB site
Description: X-ray structure of IAA-aminoacid hydrolase from Arabidopsis thaliana gene AT5G56660
Class: hydrolase
Keywords: STRUCTURAL GENOMICS, PROTEIN STRUCTURE INITIATIVE, PSI, CESG, AT5G56660, ILL2, indole-3-acetic acid, auxin, Center for Eukaryotic Structural Genomics, HYDROLASE
Deposited on 2004-10-01, released 2004-10-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: IAA-amino acid hydrolase homolog 2
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: ILL2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1xmba1, d1xmba2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xmbA (A:)
    sespwiaedtsqiqtkllefakspevfdwmvkirrkihenpelgyeeletsklirselel
    igikyrypvaitgvigyigtgeppfvalradmdalpiqegvewehkskiagkmhacghdg
    hvtmllgaakilhehrhhlqgtvvlifqpaeeglsgakkmreegalknveaifgihlsar
    ipfgkaasragsflagagvfeavitgkgghaaipqhtidpvvaassivlslqqlvsretd
    pldskvvtvskvnggnafnvipdsitiggtlraftgftqlqqrvkevitkqaavhrcnas
    vnltpngrepmpptvnnkdlykqfkkvvrdllgqeafveaapvmgsedfsyfaetipghf
    sllgmqdetngyasshsplyrinedvlpygaaihasmavqylkekaskgsvsgfheel
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xmbA (A:)
    kllefakspevfdwmvkirrkihenpelgyeeletsklirseleligikyrypvaitgvi
    gyigtgeppfvalradmdalpiqegvewehkskiagkmhacghdghvtmllgaakilheh
    rhhlqgtvvlifqpaeeglsgakkmreegalknveaifgihlsaripfgkaasragsfla
    gagvfeavitgktidpvvaassivlslqqlvsretdpldskvvtvskvnpdsitiggtlr
    aftgftqlqqrvkevitkqaavhrcnasvnltpngrepmpptvnnkdlykqfkkvvrdll
    gqeafveaapvmgsedfsyfaetipghfsllgmqdetngyasshsplyrinedvlpygaa
    ihasmavqylkekas