SCOP 1.73: Domain d1xmab_: 1xma B:

Lineage for d1xmab_ (1xma B:)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (68 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.61: PadR-like [116807] (3 proteins)
   Pfam PF03551; related to the MarR-like family (Pfam 01047)

6. Protein Predicted transcriptional regulator [116808] (1 species)
   monomeric

7. Species Clostridium thermocellum [TaxId:1515] [116809] (1 PDB entry)

8. Domain d1xmab_: 1xma B: [115478]
   complexed with hg, unx

Details for d1xmab_

PDB Entry: 1xma, 2.3 Å

PDB Description: structure of a transcriptional regulator from clostridium thermocellum cth-833

PDB Compounds: (B:) Predicted transcriptional regulator

SCOP Domain Sequences for d1xmab_:

Sequence, based on SEQRES records:

>d1xmab_ a.4.5.61 (B:) Predicted transcriptional regulator {Clostridium thermocellum [TaxId: 1515]}
vissdvirgyvdtiilslliegdsygyeiskniriktdelyvikettlysafarlekngy
iksyygeetqgkrrtyyritpegikyykqkceeweltkkvinkfvk

Sequence, based on observed residues (ATOM records):

>d1xmab_ a.4.5.61 (B:) Predicted transcriptional regulator {Clostridium thermocellum [TaxId: 1515]}
vissdvirgyvdtiilslliegdsygyeiskniriktdelyvikettlysafarlekngy
iksyygeetrrtyyritpegikyykqkceeweltkkvinkfvk

Timeline for d1xmab_:

• d1xmab_ first appeared in SCOP 1.71
  
• d1xmab_ appears in SCOP 1.75
  
• d1xmab_ appears in the current release, SCOPe 2.08, called d1xmab1