![]() | Class a: All alpha proteins [46456] (258 folds) |
![]() | Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
![]() | Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (68 families) ![]() contains a small beta-sheet (wing) |
![]() | Family a.4.5.61: PadR-like [116807] (3 proteins) Pfam PF03551; related to the MarR-like family (Pfam 01047) |
![]() | Protein Predicted transcriptional regulator [116808] (1 species) monomeric |
![]() | Species Clostridium thermocellum [TaxId:1515] [116809] (1 PDB entry) |
![]() | Domain d1xmaa_: 1xma A: [115477] |
PDB Entry: 1xma (more details), 2.3 Å
SCOP Domain Sequences for d1xmaa_:
Sequence, based on SEQRES records: (download)
>d1xmaa_ a.4.5.61 (A:) Predicted transcriptional regulator {Clostridium thermocellum [TaxId: 1515]} sdvirgyvdtiilslliegdsygyeiskniriktdelyvikettlysafarlekngyiks yygeetqgkrrtyyritpegikyykqkceeweltkkvinkfvk
>d1xmaa_ a.4.5.61 (A:) Predicted transcriptional regulator {Clostridium thermocellum [TaxId: 1515]} sdvirgyvdtiilslliegdsygyeiskniriktdelyvikettlysafarlekngyiks yygeetkrrtyyritpegikyykqkceeweltkkvinkfvk
Timeline for d1xmaa_: