SCOP 1.71: Domain d1xede_: 1xed E:

Lineage for d1xede_ (1xed E:)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (28 proteins)

6. Protein Polymeric-immunoglobulin receptor, PIGR [117038] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [117039] (1 PDB entry)

8. Domain d1xede_: 1xed E: [115233]

Details for d1xede_

PDB Entry: 1xed, 1.9 Å

PDB Description: Crystal Structure of a Ligand-Binding Domain of the Human Polymeric Ig Receptor, pIgR

SCOP Domain Sequences for d1xede_:

Sequence; same for both SEQRES and ATOM records:

>d1xede_ b.1.1.1 (E:) Polymeric-immunoglobulin receptor, PIGR {Human (Homo sapiens)}
spifgpeevnsvegnsvsitcyypptsvnrhtrkywcrqgarggcitlissegyvsskya
granltnfpengtfvvniaqlsqddsgrykcglginsrglsfdvslevleh

Timeline for d1xede_:

• d1xede_ is new in SCOP 1.71
  
• d1xede_ appears in SCOP 1.73
  
• d1xede_ appears in the current release, SCOPe 2.08, called d1xede1