Lineage for d1xedd_ (1xed D:)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 546418Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 546419Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 546420Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (28 proteins)
  6. 548178Protein Polymeric-immunoglobulin receptor, PIGR [117038] (1 species)
  7. 548179Species Human (Homo sapiens) [TaxId:9606] [117039] (1 PDB entry)
  8. 548183Domain d1xedd_: 1xed D: [115232]

Details for d1xedd_

PDB Entry: 1xed (more details), 1.9 Å

PDB Description: Crystal Structure of a Ligand-Binding Domain of the Human Polymeric Ig Receptor, pIgR

SCOP Domain Sequences for d1xedd_:

Sequence, based on SEQRES records: (download)

>d1xedd_ b.1.1.1 (D:) Polymeric-immunoglobulin receptor, PIGR {Human (Homo sapiens)}
pifgpeevnsvegnsvsitcyypptsvnrhtrkywcrqgarggcitlissegyvsskyag
ranltnfpengtfvvniaqlsqddsgrykcglginsrglsfdvslevleh

Sequence, based on observed residues (ATOM records): (download)

>d1xedd_ b.1.1.1 (D:) Polymeric-immunoglobulin receptor, PIGR {Human (Homo sapiens)}
pifgpeevnsvegnsvsitcyypptsvnrhtrkywcrqcitlissegyvsskyagranlt
nfpengtfvvniaqlsqddsgrykcglginsrglsfdvslevleh

SCOP Domain Coordinates for d1xedd_:

Click to download the PDB-style file with coordinates for d1xedd_.
(The format of our PDB-style files is described here.)

Timeline for d1xedd_: