SCOPe 2.08: Domain d1xede1: 1xed E:2-109

Lineage for d1xede1 (1xed E:2-109)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein Polymeric-immunoglobulin receptor, PIGR [117038] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [117039] (1 PDB entry)
   Uniprot P01833 20-127 # N-terminal, ligand-binding domain

8. Domain d1xede1: 1xed E:2-109 [115233]
   Other proteins in same PDB: d1xeda2, d1xedb2, d1xedc2, d1xedd2, d1xede2, d1xedf2
   complexed with mg

Details for d1xede1

PDB Entry: 1xed, 1.9 Å

PDB Description: Crystal Structure of a Ligand-Binding Domain of the Human Polymeric Ig Receptor, pIgR

PDB Compounds: (E:) Polymeric-immunoglobulin receptor

SCOPe Domain Sequences for d1xede1:

Sequence; same for both SEQRES and ATOM records:

>d1xede1 b.1.1.1 (E:2-109) Polymeric-immunoglobulin receptor, PIGR {Human (Homo sapiens) [TaxId: 9606]}
spifgpeevnsvegnsvsitcyypptsvnrhtrkywcrqgarggcitlissegyvsskya
granltnfpengtfvvniaqlsqddsgrykcglginsrglsfdvslev

Timeline for d1xede1:

• d1xede1 first appeared in SCOP 1.71, called d1xede_
  
• d1xede1 appears in SCOPe 2.07