Lineage for d1xeda1 (1xed A:2-109)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2741853Protein Polymeric-immunoglobulin receptor, PIGR [117038] (1 species)
  7. 2741854Species Human (Homo sapiens) [TaxId:9606] [117039] (1 PDB entry)
    Uniprot P01833 20-127 # N-terminal, ligand-binding domain
  8. 2741855Domain d1xeda1: 1xed A:2-109 [115229]
    Other proteins in same PDB: d1xeda2, d1xedb2, d1xedc2, d1xedd2, d1xede2, d1xedf2
    complexed with mg

Details for d1xeda1

PDB Entry: 1xed (more details), 1.9 Å

PDB Description: Crystal Structure of a Ligand-Binding Domain of the Human Polymeric Ig Receptor, pIgR
PDB Compounds: (A:) Polymeric-immunoglobulin receptor

SCOPe Domain Sequences for d1xeda1:

Sequence, based on SEQRES records: (download)

>d1xeda1 b.1.1.1 (A:2-109) Polymeric-immunoglobulin receptor, PIGR {Human (Homo sapiens) [TaxId: 9606]}
spifgpeevnsvegnsvsitcyypptsvnrhtrkywcrqgarggcitlissegyvsskya
granltnfpengtfvvniaqlsqddsgrykcglginsrglsfdvslev

Sequence, based on observed residues (ATOM records): (download)

>d1xeda1 b.1.1.1 (A:2-109) Polymeric-immunoglobulin receptor, PIGR {Human (Homo sapiens) [TaxId: 9606]}
spifgpeevnsvegnsvsitcyypptsvnrhtrkywcrqcitlissegyvsskyagranl
tnfpengtfvvniaqlsqddsgrykcglginsrglsfdvslev

SCOPe Domain Coordinates for d1xeda1:

Click to download the PDB-style file with coordinates for d1xeda1.
(The format of our PDB-style files is described here.)

Timeline for d1xeda1: