Lineage for d1xedc_ (1xed C:)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 546418Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 546419Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 546420Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (28 proteins)
  6. 548178Protein Polymeric-immunoglobulin receptor, PIGR [117038] (1 species)
  7. 548179Species Human (Homo sapiens) [TaxId:9606] [117039] (1 PDB entry)
  8. 548182Domain d1xedc_: 1xed C: [115231]

Details for d1xedc_

PDB Entry: 1xed (more details), 1.9 Å

PDB Description: Crystal Structure of a Ligand-Binding Domain of the Human Polymeric Ig Receptor, pIgR

SCOP Domain Sequences for d1xedc_:

Sequence, based on SEQRES records: (download)

>d1xedc_ b.1.1.1 (C:) Polymeric-immunoglobulin receptor, PIGR {Human (Homo sapiens)}
pifgpeevnsvegnsvsitcyypptsvnrhtrkywcrqgarggcitlissegyvsskyag
ranltnfpengtfvvniaqlsqddsgrykcglginsrglsfdvslevleh

Sequence, based on observed residues (ATOM records): (download)

>d1xedc_ b.1.1.1 (C:) Polymeric-immunoglobulin receptor, PIGR {Human (Homo sapiens)}
pifgpeevnsvegnsvsitcyypptsvnrhtrkywcrqcitlissegyvsskyagranlt
nfpengtfvvniaqlsqddsgrykcglginsrglsfdvslevleh

SCOP Domain Coordinates for d1xedc_:

Click to download the PDB-style file with coordinates for d1xedc_.
(The format of our PDB-style files is described here.)

Timeline for d1xedc_: