SCOPe 2.02: Domain d1xdkb_: 1xdk B:

Lineage for d1xdkb_ (1xdk B:)

1. Root: SCOPe 2.02

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
   multihelical; 3 layers or orthogonally packed helices

4. Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families)

5. Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 proteins)

6. Protein Retinoic acid receptor beta (RAR-beta) [117011] (2 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [117012] (1 PDB entry)
   Uniprot P22605 209-453

8. Domain d1xdkb_: 1xdk B: [115165]
   Other proteins in same PDB: d1xdka_, d1xdke_
   complexed with rea

Details for d1xdkb_

PDB Entry: 1xdk, 2.9 Å

PDB Description: crystal structure of the rarbeta/rxralpha ligand binding domain heterodimer in complex with 9-cis retinoic acid and a fragment of the trap220 coactivator

PDB Compounds: (B:) Retinoic acid receptor, beta

SCOPe Domain Sequences for d1xdkb_:

Sequence; same for both SEQRES and ATOM records:

>d1xdkb_ a.123.1.1 (B:) Retinoic acid receptor beta (RAR-beta) {Mouse (Mus musculus) [TaxId: 10090]}
aelddltekirkahqetfpslcqlgkyttnssadhrvrldlglwdkfselatkciikive
fakrlpgftgltiadqitllkaacldililrictrytpeqdtmtfsdgltlnrtqmhnag
fgpltdlvftfanqllplemddtetgllsaiclicgdrqdleeptkvdklqepllealki
yirkrrpskphmfpkilmkitdlrsisakgaervitlkmeipgsmppliqemlenseghe
pltps

Timeline for d1xdkb_:

• d1xdkb_ first appeared in SCOP 1.71
  
• d1xdkb_ appears in SCOPe 2.01
  
• d1xdkb_ appears in SCOPe 2.03
  
• d1xdkb_ appears in the current release, SCOPe 2.08